CAZyme Information: VDB83831.1

Basic Information

• Species: Blumeria graminis
• Lineage: Ascomycota; Leotiomycetes; ; Erysiphaceae; Blumeria; Blumeria graminis
• CAZyme ID: VDB83831.1
• CAZy Family: GH18
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341	LR026988|CGC6	39552.44	5.8365

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BgraminisTritici96224	8470	1268274	123	8347

• Gene Location: location=LR026988:3910049-3911074(-)

Full Sequence      

MTDFDHRPSITSEYTTSHMYKGFVSNYTASTDFCNQPDLQYLHGIMIKPLTISSTKDFFP
MFGGSKLHTNNEILLPAPMYWNNEERFSGGYDHGGPWDEKLNKVIWRGVATGGRSQADNW
KGFQRHRFVAMTNATKISDSENSRKPPENWVLPPTQYNLAAQAENRLGEWTREWADTGFV
DLNCEPSEIETCEYSSSQFSILPGMMMSEQFFRKYLPDIDGNSFSGRYRGFLLSTSLPIK
STVFREWHDSRLVPWKHFVPMDNRFIDFWGIIQYFLGYQGKTIQVDGHDEQARKIAMDGQ
DWANKVLRTEDMQIYVLRLLLEYARLSDDRRDGMGWVGDLV

Enzyme Prediction     

No EC number prediction in VDB83831.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	37	327	4.3e-74	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	7.88e-11	208	326	141	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	4.54e-09	208	326	211	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDB83831.1|GT90	2.73e-267	1	341	1	341
APA13938.1|GT90	2.31e-178	1	341	249	590
QSZ31176.1|GT90	3.76e-172	1	341	292	633
ATZ51396.1|GT90	8.47e-170	1	341	298	639
CCD42747.1|GT90	8.47e-170	1	341	298	639

PDB Hits     

VDB83831.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	1.35e-33	23	332	359	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q6UW63|PLGT2_HUMAN	3.15e-08	211	334	360	477	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
sp|Q7Z4H8|PLGT3_HUMAN	7.34e-07	214	334	368	482	Protein O-glucosyltransferase 3 OS=Homo sapiens OX=9606 GN=POGLUT3 PE=1 SV=2
sp|G5E897|PLGT3_MOUSE	1.72e-06	214	334	364	478	Protein O-glucosyltransferase 3 OS=Mus musculus OX=10090 GN=Poglut3 PE=1 SV=1
sp|Q9JHP7|PLGT2_MOUSE	1.72e-06	211	334	360	477	Protein O-glucosyltransferase 2 OS=Mus musculus OX=10090 GN=Poglut2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000014

TMHMM  Annotations     

There is no transmembrane helices in VDB83831.1.