CAZyme Information: VCU39323.1

Basic Information

• Species: Blumeria graminis
• Lineage: Ascomycota; Leotiomycetes; ; Erysiphaceae; Blumeria; Blumeria graminis
• CAZyme ID: VCU39323.1
• CAZy Family: CE4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382	LR026984|CGC3	41878.21	5.9446

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BgraminisTritici96224	8470	1268274	123	8347

• Gene Location: location=LR026984:10829133-10830348(+)

Full Sequence      

MGPFASLTAILLLLPHLTAATVKQNGKKCDCFRTTGPSGGYFTNHIFQDFRGISASPAPP
LLTSKDSSNDASVTHSYFKSPAWTKNWRIQHWNNTDSMDQTSATLMMINSLNNVYIENNP
SDPHLSWLTLRTARAPTFQAAAEIDTVPNNMLFLSVRYLARISGDPGACAGFFTYLPPGS
DPTSVQEADIEILTGAPVDHAQFTNQPSFDNQGRELKEASMNTTIPKTNDYSQWNVWRMD
WMPGQTSWYVNDVSVANISIQTPKDPAGLIMNMWSDGGLWTGNMSVGQSAYLNVQWIEIA
YNTSGVSESDRRKRDETSLSTIGRLPRRDPALCAAVCSLDENITAIGTPKLLYGRADPTW
SASSRSLCIPIALIIAGVVGIL

Enzyme Prediction     

No EC number prediction in VCU39323.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	85	299	3.1e-87	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	6.05e-47	83	299	9	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	5.93e-06	166	297	81	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185693	GH16_laminarinase_like	0.003	217	283	143	216	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	0.005	160	301	125	264	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCU39323.1|GH16_22	1.12e-289	1	382	1	382
ATZ46647.1|GH16_22	1.06e-95	5	357	4	348
CCD48311.1|GH16_22	1.06e-95	5	357	4	348
QSZ31251.1|GH16_22	6.00e-95	10	357	11	348
APA06083.1|GH16_22	4.91e-91	10	357	11	348

PDB Hits     

VCU39323.1 has no PDB hit.

Swiss-Prot Hits     

VCU39323.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000205	0.999785	CS pos: 20-21. Pr: 0.8012

TMHMM  Annotations     

There is no transmembrane helices in VCU39323.1.