CAZyme Information: VCU39209.1

Basic Information

• Species: Blumeria graminis
• Lineage: Ascomycota; Leotiomycetes; ; Erysiphaceae; Blumeria; Blumeria graminis
• CAZyme ID: VCU39209.1
• CAZy Family: AA9
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
507		58231.35	5.7573

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BgraminisTritici96224	8470	1268274	123	8347

• Gene Location: location=LR026984:9146938-9148686(-)

Full Sequence      

MLPRHNAGTGYPRSKYDLGKNTYQISPHRYQPRTSSTARRRRQTLIKLVVALSVVLLFIF
FLWPTSSIFSVLSFGFISSQGNFQLENLRYYDLSNVQGSARGWEREERILFCAPLREAES
HLNMFFSHLRNLTYPHHLIDLAFLVSDTNDRTLERLTELLEELQADDDPKQPFGEVSIIE
KDFGQKIKQDAESRHGFAAQASRRKLMAQARNWLLSASLRPTHSWVYWRDVDVETAPFTI
LEDLMRHNRDIIVPNVWRPLPDWLGGEQPYDLNSWQESETALALAETLDEDAVIVEGYAE
YATWRPHLAYLRDPYGDPDMEMDIDGVGGVSILAKARVFRYGVHFPAFSYEKHAETEGLG
KMAKRMKFSVVGLPHYTIWHMYEPSEDDVHHMKEMEQERKAREKEEEEKAVRTQKIKETF
ADPNAQWEKDKSIIQNLAKEEKLADKPSEDSNKSKDSTTEVSGSQTESKGPEKDSSVSQK
PPVENESASSQDSTVISKKVPGTEDKV

Enzyme Prediction     

No EC number prediction in VCU39209.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	87	349	2.3e-122	0.9850746268656716

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	3.24e-149	90	349	4	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCU39209.1|GT62	0.0	1	507	1	507
QSZ34290.1|GT62	2.42e-252	1	471	1	474
ATZ55714.1|GT62	3.38e-251	1	471	1	476
CCD52067.2|GT62	3.38e-251	1	471	1	476
APA12986.1|GT62	2.47e-249	1	471	13	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	3.05e-59	87	383	5	302	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74745|ANP1_SCHPO	5.55e-160	13	414	2	405	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P32629|ANP1_YEAST	5.81e-154	50	437	15	412	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|P23642|VAN1_YEAST	4.80e-120	91	400	175	531	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	3.82e-118	87	400	75	438	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	3.25e-58	87	383	72	368	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999932	0.000087

TMHMM  Annotations     

Start	End
45	67