CAZyme Information: VCU38914.1

Basic Information

• Species: Blumeria graminis
• Lineage: Ascomycota; Leotiomycetes; ; Erysiphaceae; Blumeria; Blumeria graminis
• CAZyme ID: VCU38914.1
• CAZy Family: AA2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
271		29908.66	8.7734

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BgraminisTritici96224	8470	1268274	123	8347

• Gene Location: location=LR026984:2707305-2708180(-)

Full Sequence      

MLEEAVEYLEAEYGRKPKQLEKSKVTREQPSGHRVVGGYEILIVNDGSSDKTVEVALEFG
RRHNLHDILRVCTLKTNRGKGGAVIHGFRHVRGAYALFADADGASRFTDVHKLVEGCKEV
VDASGRAVSVGSRAHLVESEAVVKRSLIRNVLMHSFHLLLLLLTPPATSRIRDTQCGFKL
FSRPALPYIVPYMHAEGWIFDVEMLMLAESAPPALLPGGGETDAGIRVKEVFIGWKEVGG
SKLNVICDSLGMAYGLALLRAGWMLGVYRRW

Enzyme Prediction     

No EC number prediction in VCU38914.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	38	119	6.7e-18	0.4588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133031	DPG_synthase	3.84e-76	1	242	15	211	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
240336	PTZ00260	6.35e-71	1	269	88	322	dolichyl-phosphate beta-glucosyltransferase; Provisional
133022	DPM_DPG-synthase_like	1.79e-40	39	208	29	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
395426	Glycos_transf_2	5.09e-19	39	186	28	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
133045	CESA_like	1.70e-14	39	151	27	140	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCU38914.1|GT2	2.53e-196	1	271	1	271
QLI64092.1|GT2	1.10e-121	2	270	134	414
QSZ30928.1|GT2	7.84e-121	1	270	131	380
ANH56605.1|GT2	3.24e-119	2	270	159	439
QGI91092.1|GT2	1.12e-117	2	270	132	408

PDB Hits     

VCU38914.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O60061|ALG5_SCHPO	4.71e-64	1	270	80	315	Dolichyl-phosphate beta-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg5 PE=3 SV=1
sp|P40350|ALG5_YEAST	4.17e-62	39	269	107	329	Dolichyl-phosphate beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG5 PE=1 SV=1
sp|Q9VLQ1|ALG5_DROME	7.27e-48	15	269	80	317	Dolichyl-phosphate beta-glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=wol PE=1 SV=1
sp|Q54J42|ALG5_DICDI	2.93e-47	39	269	112	324	Dolichyl-phosphate beta-glucosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg5 PE=2 SV=1
sp|Q9DB25|ALG5_MOUSE	6.99e-44	15	269	79	316	Dolichyl-phosphate beta-glucosyltransferase OS=Mus musculus OX=10090 GN=Alg5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in VCU38914.1.