CAZyme Information: VBB87087.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB87087.1
• CAZy Family: GT35
• CAZyme Description: Putative Glycosyltransferase Family 22

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
649		73066.78	8.1218

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026970:3150774-3152829(-)

Full Sequence      

MVKMEKDTVKKPPGPRIEKPAEKDGRVHAQVAAAQVGDILSVLLAFRFINSLFVKTFFQP
DEYFQALEPAWRMAFGEGSGAWMTWEWEYQLRSSLHPAVFGAAYKLAETVMSAMHLFPPF
IASMLVVLPGALQSVFAALGDFYTWKLAMDVYGRESYAPWAALWMTVLNPWQWYCSTRTF
SNSLETTLTIAALSYWPWELLADAKETKEERLKQKGRLNSLRTSLFLAAIAVLLRPTNLF
IWLGIIALTLTRLTLNGQSPIIQTTFPALLRETVLCGSVALAISVVSDRLYFGFWTFPPY
KWLYFNMSQSLAVFYGRMPWHYYLSQGIPLLTTTFLPFALLGIYKATLTSAKPTTLLSAR
PTSLSTTSSNTLKTLSFALIGMITILSPISHKEVRFIYPLLPILHILAAPYVTSFFTTPP
TTLSKPLVLRHKIFLANILSINLLLAGYLSLFHQPAPISVLSFLRSEYERLHPDSLSLSA
PPQEQKELFALFLTPCHTTPWRSHLVWPGLRARALTCEPPLHTAPGTPERENYLDEADRF
YAEDAETGKYGGVFLRREMWPQFFDGGDGRKGEEIPRFVVGFEGIEGVLGEFFGGEGEKM
GVKMKKVWEGWNGLVNEDWRRGGRLVVWDTGVYPDGGGEMVDGGSRDEL

Enzyme Prediction     

No EC number prediction in VBB87087.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	39	505	3.8e-106	0.9948586118251928

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215437	PLN02816	1.56e-61	16	540	4	476	mannosyltransferase
281842	Glyco_transf_22	1.61e-61	39	505	2	413	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB87087.1|GT22	0.0	1	649	1	649
CDP32608.1|GT22	0.0	1	649	1	648
CAP69128.1|GT22	0.0	1	649	1	648
AEO57416.1|GT22	1.19e-297	9	639	19	659
AEO69608.1|GT22	3.97e-272	27	634	41	667

PDB Hits     

VBB87087.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4IB63|GPI10_GIBZE	3.31e-216	43	635	27	606	GPI mannosyltransferase 3 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI10 PE=3 SV=1
sp|Q4WPG0|GPI10_ASPFU	1.90e-142	38	628	53	645	GPI mannosyltransferase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi10 PE=3 SV=1
sp|Q2UH15|GPI10_ASPOR	6.30e-124	43	628	61	627	GPI mannosyltransferase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi10 PE=3 SV=1
sp|Q5BCB9|GPI10_EMENI	2.50e-106	38	628	51	565	GPI mannosyltransferase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi10 PE=3 SV=1
sp|Q6CAB8|GPI10_YARLI	6.61e-75	39	629	18	509	GPI mannosyltransferase 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI10 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000017	0.000006

TMHMM  Annotations     

Start	End
115	137
157	174
224	246
261	283
290	312
322	344
396	418
433	452