CAZyme Information: VBB86718.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB86718.1
• CAZy Family: GT32
• CAZyme Description: Putative Glycosyltransferase Family 22

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485		55327.66	9.4366

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026970:1908029-1909896(-)

Full Sequence      

MWRRTYLFLVLVRLWFALSPSYLHPDENFQGPEVIAGQIFKYPVRHTWEFTSENPIRSVF
PLWPVYGLPMLLLRWLWIGNGNDGEIPPIAVFWTLRVLMFVVGFVLEDWAIYELIRSPRH
RRLAVLLVASSYVTWTYQTHTFSNSIESLVVAWCLVLIERIVGSPQESTVLASTVLGVVA
VFGVFNRITFPAFLLIPGLRLLPYYFKNPLSFLAIVTAGLFTTGLAIALDTAFYTPHSIT
WSDLIHNPVLTPLNNLIYNLDPENLAKHGLHPWYQHILVNLPQLLGPGALLLFTRPQLSL
RLYSAISGIVVLSISQHQEARFLLPTVPLILSSVRLPKSEKLTRIWTVSWIIFNFIFGAL
MGTYHQGGVIPAQVFLSKQPDATQAVWWKTYSPPIWLLNGKNEVLTTKDVMGLAGDKLLA
QLTELATCDLPADRRSNEYKRHLNMDDLDFGEDGVWNTLERVVGRRGLGIWRVTRTCPER
RGSWR

Enzyme Prediction     

EC	2.4.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	5	397	1.1e-80	0.9897172236503856

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	5.58e-53	5	396	2	410	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	0.001	3	331	39	351	mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB86718.1|GT22	0.0	1	485	1	485
AEO57845.1|GT22	2.54e-299	1	482	1	520
UNI14407.1|GT22	8.82e-280	1	477	1	515
UQC77828.1|GT22	3.72e-279	1	477	1	515
QLI65346.1|GT22	1.09e-277	1	479	1	517

PDB Hits     

VBB86718.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I785|SMP3_GIBZE	1.38e-272	1	479	1	517	GPI mannosyltransferase 4 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=SMP3 PE=3 SV=2
sp|Q2UTP0|SMP3_ASPOR	9.23e-176	1	475	1	539	GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=smp3 PE=3 SV=1
sp|Q4WTT7|SMP3_ASPFU	9.08e-172	1	475	1	543	GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=smp3 PE=3 SV=2
sp|Q5BAX7|SMP3_EMENI	1.55e-159	1	475	1	538	GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=smp3 PE=3 SV=2
sp|Q6CDD0|SMP3_YARLI	1.33e-93	10	412	13	414	GPI mannosyltransferase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SMP3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000383	0.999588	CS pos: 17-18. Pr: 0.9310

TMHMM  Annotations     

Start	End
59	78
93	115
168	190
210	229
345	367