CAZyme Information: VBB86450.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB86450.1
• CAZy Family: GT31
• CAZyme Description: Putative Glycoside Hydrolase Family 5

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465	LR026970|CGC8	49686.32	9.1256

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026970:994927-996441(+)

Full Sequence      

MRLAGTFLTAAAAIIGAAAAPGTTTLGPRQQSSTITVDLTRTFQKMDGFGFSLAFQRANL
ITNMSDKTKQKELLDLLFNRTTGAGFTILRNGIGSTPNSNSDFMNTIAPRNPGGPRATPQ
YVWDGKDNAWSAPGYMKTNNNDANGGTLCGVPGASCSSGDWRQAYADYLVAYIKFYAQEG
VPITHLGFLNEPDYTASYASMRSDGNQAADFIKILYPTLEAANLTSQLGIACCETMGWGS
AVNMINSIRSQGQEGRLKTVTSHTYTGGPSSPMNSRNPVWFSEQCDLNGQWTTSWYSNGG
AGEGLTWANNVYSAVVSYNASGYLYWEGVQWPNPNTNEKIIRVDNRTNTYEVSKRLWAFA
NWSRYVRPGAVRVGTSGGSGVRTAAFRNEDGTIAVVVISTTGSAVNVNVRVSGGGTPIYA
QAFVSDNTRNAASTPATLGADGTVSGQVAARSITTFFILPGARKS

Enzyme Prediction     

EC	3.2.1.8:3	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	128	456	3.4e-139	0.7336343115124153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227807	XynC	6.16e-22	32	420	33	416	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
407314	Glyco_hydro_30C	6.01e-09	369	414	1	48	Glycosyl hydrolase family 30 beta sandwich domain.
307945	Glyco_hydro_30	1.85e-06	130	223	101	194	Glycosyl hydrolase family 30 TIM-barrel domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB86450.1|GH30_7	0.0	1	465	1	465
CDP31966.1|GH30_7	0.0	1	465	1	480
CAP68494.1|GH30_7	3.24e-301	1	465	1	454
AEO57693.1|GH30_7	1.19e-247	16	460	3	468
VBB81111.1|GH30_7	6.29e-172	30	465	24	484

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7NCX_AAA	1.20e-151	26	462	3	458	Chain AAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7O0E_A	1.77e-151	33	462	3	451	Chain A, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6M5Z_A	1.49e-107	34	458	24	453	Chain A, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
6IUJ_A	1.88e-107	18	409	7	421	Chain A, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	5.99e-106	35	409	95	492	Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q1N4|XY30A_MYCTT	5.64e-153	13	462	7	475	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000354	0.999610	CS pos: 29-30. Pr: 0.4209

TMHMM  Annotations     

There is no transmembrane helices in VBB86450.1.