CAZyme Information: VBB86284.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB86284.1
• CAZy Family: GT24
• CAZyme Description: Putative Glycoside Hydrolase Family 55

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
788		85748.68	4.6072

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026970:498518-500884(-)

Full Sequence      

MGLSKLSTLLLLAIGVVSPSVAAPAPRQESGWWLSTIKRQGNAAFNADPANYKVFRNVQD
YGAKGDGATDDTEAINRAISDQNRCGLGCTSQTTTPGLVYFPPGTYRVSKPIIPYYYTQM
VGDAINPPTLKATADFEGMAVIDADPYENDGRNWWTNQNNFFRQVRNFVIDIKDMPFDKG
AGIHWQVAQATSLHNIVFNMREDGGSANKQLGIFMDNGSGGFMVDLTFNGGQYGAFFGNQ
QFTTRNLTFNRCQTAIYMNWNWAWTFQDVHINDCQVGIDMSNGGPEGQTVGSVLMVDSVF
TNTPTGIKTAYNPDSPQTNGTLILDNVDFSGSQQAVLNNATQSVILEGNQKVDFFVQGKT
YGGAVSGAAAGRAVQSAQQNVRKPASLLDQATGKVFTRTKPQYEDVPVGNFVSVKSQGAK
GDGKTDDTDAIQKIFDSVTPDQVVYFDHGAYIITKTVKVPKDIKITGEIWPLILAGGDQF
FKDQANPKPVFQVGQPGDVGNVEMSDLIFGTAGPQPGAIIMEWNVKGTTPGAAGLWDVHT
RIGGYRGTELELEQCAKNPNVTNTIPEQCFGSFMMLHIPAGGSAYLENTWYWVADHSLEP
EAKDGQIDVFNGRGVLIEGEGPVWGWATASEHSVLQNYQFNNASNIWLALIQTETPYFQG
NPDATKPFTVNPTYADPDFEKSCANSSDPTCKRAWGVRAINSKDIFIYGAGLYSFFDNYG
QDCVKSQDCQVNMVSLEDSAVHFYGLSTKASVNMLTVNGEGVALDKDNRNNFCATLALFT
SEPQAQAA

Enzyme Prediction     

EC	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	26	780	0	0.9891891891891892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	1.46e-100	55	279	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	3.21e-09	411	480	1	74	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	3.36e-05	57	112	84	129	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB86284.1|GH55	0.0	1	788	1	788
CDP31798.1|GH55	0.0	1	788	1	788
CAP68327.1|GH55	0.0	1	788	1	788
AEO58209.1|GH55	0.0	3	781	2	779
ACS66685.1|GH55|3.2.1.58	0.0	1	781	1	783

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	0.0	30	781	4	755	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	1.44e-223	32	780	26	756	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
7CHU_A	6.70e-08	27	133	43	150	Chain A, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	0.0	6	779	11	873	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P49426|EXG1_COCCA	3.36e-192	18	776	34	781	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	1.21e-57	5	768	3	744	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000204	0.999794	CS pos: 22-23. Pr: 0.9888

TMHMM  Annotations     

There is no transmembrane helices in VBB86284.1.