CAZyme Information: VBB84839.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB84839.1
• CAZy Family: GT2
• CAZyme Description: Putative Glycoside Hydrolase Family 55

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
800		86573.03	4.5228

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026969:3992852-3995439(-)

Full Sequence      

MKRINPLWLLAASLVRATFWMEDLSHQGIASFNPDRGYQVFRNVRDFGAKGDGVTDDTAA
INAAMSHGNRCGGYGCIGATINPAIVYFPPGTYLISSPIVGLFYTQMIGDPTDMPVIKGG
SNFTQDGKALLDADPYLSNGKLNFISTNVFFRQVRNLVFDTTAIPHQTWAVHWPSAQATV
IHNCVFRLSPNFEDGHTGIYMEEGSGGMLTDLVFYGGQYGAQFGSQQYTVRNLTFHGSQT
AILQVWNWGFTYKSLSINDCEIGLNMSSPDVGSVTLLDSSFTNVDTAIIVGRHNSSATGL
GSLLIQNVKYTNVPTVMKDLDGNQVLAGNASGALFECGYAKGNLYAPEGPSAFEGRDIAF
DQPSALKLGDQYYERSKPQYEGYPTGAFVSARNHYAVGDGVTDDTVALNSFFDVATEPTV
VGFLDAGFYRVTDTVYIPAGARVVGEGLAAVIMGAGKKFSDVTNPRPVVQIGKPGELGYV
EISDIIVSTQGPTAGAIAIEYNLNTPILDGNITVDTPPSGLWDVHVRIGGFGGSKLQVAE
CPITPNITNVVEPACIAGYMSMHITPSAGNLYMENNWMWVADHDIEDWNQTRIDVFAGRG
LLIEGSNIWMLGNAVEHHTLYQYQLVNASNLWMGQIQTETPYYQPNPQAPYPFTQVNTTL
HDPDFMTDCPGSSPSTVEQLPGDPPCAMAWAMRIIGSKNITVFGAGLYSFFNNYCTNCST
NHAGENCQARIFSIQDANGTEVVNSTTGLQMYNLNTIGSVSMLTNKGEDVAFWNETIATY
ASTMGIFRNDGNGTNVSSTS

Enzyme Prediction     

EC	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	16	787	8.5e-257	0.9837837837837838

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	1.25e-88	41	265	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	8.89e-05	43	102	84	132	Polygalacturonase [Carbohydrate transport and metabolism].
215120	PLN02188	3.20e-04	43	97	38	83	polygalacturonase/glycoside hydrolase family protein
403800	Pectate_lyase_3	4.99e-04	388	502	1	122	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
314993	End_N_terminal	0.003	49	66	1	18	N terminal extension of bacteriophage endosialidase. This domain family is found in bacteria and viruses, and is approximately 70 amino acids in length. This domain is found in the bacteriophage protein endosialidase. The two N-terminal domains (this domain and the beta propeller) assemble in the compact 'cap' whereas the C-terminal domain forms an extended tail-like structure. The very N-terminal part of the 'cap' region (residues 246 to 312) holds the only alpha-helix of the protein and is presumably the residual part of the deleted N-terminal head-binding domain. The endosialidase protein complexes to form homotrimeric molecules.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB84839.1|GH55	0.0	1	800	1	800
CDP31588.1|GH55	0.0	1	800	1	761
CAP65594.1|GH55	0.0	1	800	1	761
AEO64870.1|GH55	0.0	7	788	8	782
AEO61209.1|GH55	0.0	15	759	15	760

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	2.23e-217	19	788	6	754	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	7.49e-193	19	770	26	738	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
7CHU_A	3.26e-06	43	99	76	128	Chain A, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P49426|EXG1_COCCA	6.15e-219	11	785	40	782	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|D4B0V1|E13B_ARTBC	5.33e-185	17	787	41	873	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P53626|E13B_TRIHA	2.76e-44	16	719	33	700	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.907854	0.092154

TMHMM  Annotations     

There is no transmembrane helices in VBB84839.1.