CAZyme Information: VBB84545.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB84545.1
• CAZy Family: GT1
• CAZyme Description: Putative Glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
537		60151.21	7.4050

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026969:3229995-3231678(-)

Full Sequence      

MSADQSSDETLSKCTILLVTGTGGFTHAAPVLELGRLLASRGHTIHFATHKTQEKWILTN
PSYAFISPAHIHPMGDPLTPQQEEAHYLALQNTDIRVDYKSYFAPKYTVDAFWTSDYTHL
LRITKAISPDAIVTDFFVEATRDMQKQFGVPVAMVWPQMPYGMVSAGHIPGIPGFQVDAL
TSEKASLWQRIRAALRPLRAITTVVPYLRWVKRMRREAGVNYPLAGVTAGKPDYLGLVNS
FWGLETPKDCPPLLQAVGPILSEEYPGLDGELRGFYERGKKRRVVYVCFGTHITLPTEQV
VMFLGALGDLLADGLVDGVIWTVGKKQRQQFQPLLNQWTGGVREPVGMLLENQSERWYFT
PFAPQRAILDHPDTILFVTHGGGSSVNEAMYHGVRMLSLGFFFDQLLNCLRIVEAGVGLG
LDKATFTRDEIYDKGRQVLVDEDGSFARNVERMRHIARISARKKHYAADLIEEMMYDAKF
GLDPNSGNMRPMHLQTADVRMPIWKAKNLDLLLLGGLATAGFAGVSYWLYSWISDQL

Enzyme Prediction     

No EC number prediction in VBB84545.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	207	458	1.1e-32	0.5471204188481675

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.29e-54	16	474	3	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	5.50e-28	15	475	3	399	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
273616	MGT	1.73e-17	23	475	4	390	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
223071	egt	3.00e-15	251	458	264	447	ecdysteroid UDP-glucosyltransferase; Provisional
278624	UDPGT	3.04e-14	237	456	230	421	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB84545.1|GT1	0.0	1	537	1	537
CAP65310.1|GT1	0.0	74	537	1	464
CDP31307.1|GT1	0.0	74	537	1	464
QLI65751.1|GT1	6.26e-152	15	525	7	511
BCR88254.1|GT1	2.37e-150	16	529	11	528

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WC4_A	2.78e-10	128	449	107	413	Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase from Clitoria ternatea [Clitoria ternatea],4REL_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with kaempferol [Clitoria ternatea],4REM_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with delphinidin [Clitoria ternatea],4REN_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with petunidin [Clitoria ternatea],4WHM_A Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase in complex with UDP [Clitoria ternatea]
2C1X_A	2.86e-10	266	457	256	429	Structure and activity of a flavonoid 3-O glucosyltransferase reveals the basis for plant natural product modification [Vitis vinifera],2C1Z_A Structure and activity of a flavonoid 3-O glucosyltransferase reveals the basis for plant natural product modification [Vitis vinifera],2C9Z_A Structure and activity of a flavonoid 3-0 glucosyltransferase reveals the basis for plant natural product modification [Vitis vinifera]
7Q3S_A	3.08e-10	237	479	216	477	Chain A, Glycosyltransferase [Zea mays]
7CJX_A	7.62e-10	364	441	78	155	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
6IPB_A	1.20e-09	364	441	99	176	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P19488|UDB37_RAT	1.62e-13	228	439	250	434	UDP-glucuronosyltransferase 2B37 OS=Rattus norvegicus OX=10116 GN=Ugt2b37 PE=1 SV=1
sp|P36513|UDB14_RABIT	3.77e-13	230	450	252	443	UDP-glucuronosyltransferase 2B14 OS=Oryctolagus cuniculus OX=9986 GN=UGT2B14 PE=2 SV=1
sp|P36512|UDB13_RABIT	5.01e-13	230	441	253	437	UDP-glucuronosyltransferase 2B13 OS=Oryctolagus cuniculus OX=9986 GN=UGT2B13 PE=2 SV=1
sp|Q6UWM9|UD2A3_HUMAN	1.15e-12	228	456	247	446	UDP-glucuronosyltransferase 2A3 OS=Homo sapiens OX=9606 GN=UGT2A3 PE=2 SV=2
sp|A0A2Z5CV93|U70G2_CROXC	1.32e-12	24	414	17	391	Myricetin 3-O-rhamnoside 1,2-glucosyltransferase UGT709G2 OS=Crocosmia x crocosmiiflora OX=1053288 GN=UGT709G2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

Start	End
511	533