CAZyme Information: VBB84441.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB84441.1
• CAZy Family: GH94
• CAZyme Description: Putative GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
634	LR026969|CGC16	68382.23	8.0700

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026969:2962090-2964185(+)

Full Sequence      

MSLSKFCLLASASLVSLATGLSTPHANIKRQVSQLRESYDFVIVGGGTSGLTVADRLSEA
FPQKTVLVVEYGDVEYAPSSFDPPVDWYGPNSFQSASLWVFFSQPNPEYNNLTALSFAGQ
VVGGSSAINGQFFDRPSRHDLDSWTQLGVSSDWNWRGMFPYFKKSIKFTAPSAQVAQQYN
YTWDLSSYGGTTPIHSSFPPFQWADNSVVLNGWRELGVRTRQDCAGGDKEGLCAVPTSQH
PITARRSHAGLGHYADVVGTRSNYDLLVKHQAVRVVYPNGVNSGPPLLDVRSLTTNARFN
ITANAEVVLSAGAYHTPTVLLRSGIGAANILAASGIAQVLELPGVGANLQDHPGSTGVAW
NYTKPGNWTPMPEEMADPTFKADATAAFDEVPARGPYTMALGNQAIYISLPNTTPNYLSI
IRKILRQTVDGSAASFLPADYRDNAALARGYRDQLAVLAKLLLNPKAPNLETPWSTGYSA
PAILLHPLSRGTVRLNPADHLAQPIVDSRHGSNPVDFDMQLANVKWSRRLLDTPTMKRYG
AVETAPGEAVQSDAELLAFIKSAATLSYQHPCCTAALGPKNKGGVVDNKLRVHGAKGLRV
VDISVLPLVISAHTSSTAYALGEKAADVIIKEWR

Enzyme Prediction     

No EC number prediction in VBB84441.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	38	631	1.3e-153	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.38e-72	37	632	6	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	8.69e-66	37	629	4	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.57e-38	487	625	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.09e-22	110	353	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.91e-06	22	353	39	328	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB84441.1|AA3_2	0.0	1	634	1	634
CDP31201.1|AA3_2	0.0	1	634	1	634
AEO67447.1|AA3_2	1.39e-263	10	634	7	641
QRD01783.1|AA3_2	1.15e-206	133	633	3	507
UQC77231.1|AA3_2	7.68e-126	15	629	20	620

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	1.55e-269	11	633	5	642	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	1.37e-99	35	634	2	587	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6XUT_A	4.84e-60	37	629	15	587	Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUU_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina],6XUV_A Chain A, Oligosaccharide dehydrogenase [Trametes cinnabarina]
4YNT_A	9.24e-53	38	629	5	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
1CF3_A	1.63e-45	40	633	21	579	GLUCOSE OXIDASE FROM APERGILLUS NIGER [Aspergillus niger],1GAL_A CRYSTAL STRUCTURE OF GLUCOSE OXIDASE FROM ASPERGILLUS NIGER: REFINED AT 2.3 ANGSTROMS RESOLUTION [Aspergillus niger],3QVP_A Crystal structure of glucose oxidase for space group C2221 at 1.2 A resolution [Aspergillus niger],3QVR_A Crystal structure of glucose oxidase for space group P3121 at 1.3 A resolution. [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	5.91e-92	25	629	24	613	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	2.26e-73	37	630	45	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	2.26e-73	37	630	45	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	5.14e-60	39	632	36	610	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	2.57e-56	38	632	39	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.009881	0.990095	CS pos: 20-21. Pr: 0.9518

TMHMM  Annotations     

There is no transmembrane helices in VBB84441.1.