CAZyme Information: VBB84362.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB84362.1
• CAZy Family: GT76
• CAZyme Description: Putative protein of unknown function

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
185		21060.74	5.1470

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026969:2741038-2741771(+)

Full Sequence      

MGHDWICYLPWHWNSIKVPIFLLLPWLPLGWTLFLLDTLVMSEPEQDYLLPDEWNGRVVY
LFSESTGNVLDLHGGQSHNGNKVQGWQYLGSKAQQWRLQKVDSGPFGAWVLHNVASGTVL
DLDGGSPDDCTKIMGWKYYSGNGNQEWLIITKKYNDGSQCILQNRNSFSVADMSEGKRDN
GYVFS

Enzyme Prediction     

No EC number prediction in VBB84362.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404972	RicinB_lectin_2	1.45e-13	55	136	11	89	Ricin-type beta-trefoil lectin domain-like.
404972	RicinB_lectin_2	1.94e-10	93	181	2	83	Ricin-type beta-trefoil lectin domain-like.
411518	lectin_1	1.89e-04	46	147	748	834	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.
238092	RICIN	0.001	63	149	48	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
411519	lectin_2	0.002	70	147	170	238	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB84362.1|CBM13	1.61e-120	1	185	1	185
CZS82853.1|CBM13	1.22e-18	41	181	12	169
SCB65972.1|CBM13	5.17e-18	41	181	12	169

PDB Hits     

VBB84362.1 has no PDB hit.

Swiss-Prot Hits     

VBB84362.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998669	0.001343

TMHMM  Annotations     

Start	End
13	35