CAZyme Information: VBB84081.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB84081.1
• CAZy Family: GH76
• CAZyme Description: Putative Protein ADG3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479		50039.34	7.1784

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026969:1995100-1996657(+)

Full Sequence      

MKLTTTLQAVIGSASFLFAAQPALAGHVHGGHRHAHERYARRQNHHSHMAGEVIGASRIA
ARKAPCSLPDDPDLVRVPGDVNNGFAMSPDEPCEDGKWCPIACRSGKVMAQWKPHTKYTY
PESMYGGLYCDGGKPMKPFKEKPYCVDGTGAVKAVNKCGKVVSFCQTVLPGNEAMIIPTD
VSDTMTLSVPDASYWAQTAAHYYVNPPGVDASRGCVWGKITEAIGNWSPYVAGANTQRSG
ETFVKIAWNPEYMTTDNSKNTPTYGLKIECPDGGCNGLPCVIDPTKSGVGGVESPNTASV
DGGANFCVVTVPKGKTANIVVFNTDGSTGEKPKPKEEPKPKPKEEPKPTPKPEPTTVAKV
PKTTAAPPSSTTEAAFSIKKVNPTTSKSWSSESTSDPYFMGGIFLESTAVGKTKTYSDIE
PTATAETVTTTEADGADSRAAAAAAAASTSPSNEGGAADHGGSAIAGLVVAIVAAAALL

Enzyme Prediction     

No EC number prediction in VBB84081.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	63	319	1.5e-83	0.834983498349835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	1.13e-112	62	308	2	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB84081.1|GH132	1.00e-307	1	479	1	479
CAP71487.1|GH132	1.64e-302	1	479	1	481
CDP30883.1|GH132	1.64e-302	1	479	1	481
AEO66700.1|GH132	1.10e-167	5	332	4	330
AEO55128.1|GH132	3.75e-159	5	329	4	329

PDB Hits     

VBB84081.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74851|ADG3_SCHPO	1.49e-79	66	323	73	335	Probable secreted beta-glucosidase adg3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=adg3 PE=2 SV=1
sp|Q04018|YM79_YEAST	6.14e-79	43	338	39	333	Uncharacterized protein YMR244W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMR244W PE=3 SV=1
sp|P46955|NCA3_YEAST	7.73e-27	93	306	122	334	Beta-glucosidase-like protein NCA3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NCA3 PE=3 SV=1
sp|Q9UR09|PSU1_SCHPO	5.44e-25	93	283	203	392	Probable secreted beta-glucosidase PSU1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psu1 PE=3 SV=1
sp|Q4WGL5|SUN1_ASPFU	1.69e-22	81	269	186	374	Secreted beta-glucosidase sun1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=sun1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000447	0.999498	CS pos: 25-26. Pr: 0.9681

TMHMM  Annotations     

There is no transmembrane helices in VBB84081.1.