CAZyme Information: VBB83821.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB83821.1
• CAZy Family: GH76
• CAZyme Description: Putative Glycosyltransferase Family 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
451		49512.98	7.7744

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026969:1088148-1089571(+)

Full Sequence      

MAADTSNTTERLVAAATQLISLLFTTAREQPIRLFFLFVFPLALFGIISIYLLLHLLAPK
PRPPYPSEKTYLTTLPSGAISPPRPLPCWYDRWHAEGCLKEQYPTVPDGFDVPDQANIEP
AEVEVSVVVPAYNEQDRIEVALEEMVEYLDANFGRGQEGGFGRLLPTLERPKPGVGTPGS
RPSTPHRLVFKCENALGGGRGQSPPRERPPRGYEIIVVDDGSEDRTVEVVLEFGRRRGLH
DVLRVVSLEKNRGKGGSVTHGLRHVRGKYAVFADADGASRFSDLGRLIEGCEDVVDGSNR
GVAIGSRAHLVGSEAVVKRSAIRNFLMRSFHFVLMILTPPATSRIRDTQCGFKLFSRAAL
PHIVPYMHAEGWIFDIEMLMLAESAPATPVLASDGSVIGTSYGIKVAEVPVGWEEVGGSK
MSLVKDSVRMAVGLAVLRASWMLGVYRRRLT

Enzyme Prediction     

No EC number prediction in VBB83821.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	208	314	1.5e-20	0.5882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133031	DPG_synthase	9.22e-90	127	420	1	211	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
240336	PTZ00260	3.42e-73	117	447	64	322	dolichyl-phosphate beta-glucosyltransferase; Provisional
133022	DPM_DPG-synthase_like	1.12e-49	127	382	1	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
395426	Glycos_transf_2	4.50e-22	206	360	21	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
133062	DPM1_like	4.73e-19	213	423	28	211	DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. This protein family belongs to Glycosyltransferase 2 superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB83821.1|GT2	0.0	1	451	1	451
CDP30616.1|GT2	0.0	1	451	1	451
CAP71217.1|GT2	3.59e-293	50	451	1	402
AEO55352.1|GT2	7.94e-226	12	451	8	452
UKZ74253.1|GT2	1.37e-188	16	451	4	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	6.77e-06	209	276	41	102	Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O60061|ALG5_SCHPO	2.64e-73	123	448	62	315	Dolichyl-phosphate beta-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg5 PE=3 SV=1
sp|P40350|ALG5_YEAST	4.77e-67	47	447	23	329	Dolichyl-phosphate beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG5 PE=1 SV=1
sp|Q54J42|ALG5_DICDI	1.43e-48	87	447	41	324	Dolichyl-phosphate beta-glucosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg5 PE=2 SV=1
sp|Q9Y673|ALG5_HUMAN	3.97e-46	100	447	50	316	Dolichyl-phosphate beta-glucosyltransferase OS=Homo sapiens OX=9606 GN=ALG5 PE=1 SV=1
sp|Q9DB25|ALG5_MOUSE	2.11e-45	100	451	50	320	Dolichyl-phosphate beta-glucosyltransferase OS=Mus musculus OX=10090 GN=Alg5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000008

TMHMM  Annotations     

Start	End
34	56