CAZyme Information: VBB82090.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB82090.1
• CAZy Family: GH67
• CAZyme Description: Putative Polysaccharide Lyase Family 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
249		25735.69	7.9873

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026968:4412264-4413013(-)

Full Sequence      

MHPLTLLLASMAGLATAQTNTALRSTFPIPSATTHLSAVRTIPAGQTLDGGMKQWDRSPS
TCSDQSEGGEKDAVFILQDGATLSNVIIGPNNGEGVHCKGTCTLNNVWWTDVCEDAATFR
QTSGTSYVNGGGARGASDKVFQHNGGGLVAVKNFYAANIGKLYRSCGNCGTQYARHSTFD
NIKVEGSSQVVAGVNANFGDTTSVRNSCLLKGAACWIYQGNNSGKEPTKIGSGPSGTACA
TAAIKTSGC

Enzyme Prediction     

EC	4.2.2.2:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	31	220	4.1e-77	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	1.19e-105	25	225	2	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB82090.1|PL3_2	2.43e-183	1	249	1	249
CAP65892.1|PL3_2	9.88e-183	1	249	1	249
CDP30245.1|PL3_2	9.88e-183	1	249	1	249
QEI10431.1|PL3_2	2.64e-125	1	249	1	248
CBY00371.1|PL3_2	1.43e-110	1	249	1	277

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	1.79e-32	42	184	11	150	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	2.36e-23	42	183	16	157	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	2.42e-23	42	183	17	158	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	2.17e-22	42	183	25	166	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4YZ0_A	2.17e-22	42	183	25	166	C. bescii Family 3 pectate lyase double mutant K108A/E39Q in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4YZ0_B C. bescii Family 3 pectate lyase double mutant K108A/E39Q in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DBJ7|PLYE_NEOFI	9.04e-67	24	239	31	245	Probable pectate lyase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyE PE=3 SV=1
sp|Q5BA88|PLYD_EMENI	3.49e-66	24	239	37	255	Probable pectate lyase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyD PE=3 SV=1
sp|Q5B7Z3|PLYE_EMENI	3.63e-66	24	235	31	242	Pectate lyase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyE PE=1 SV=1
sp|Q4WC29|PLYE_ASPFU	2.07e-65	24	239	31	245	Probable pectate lyase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyE PE=3 SV=1
sp|B0Y9M8|PLYE_ASPFC	2.07e-65	24	239	31	245	Probable pectate lyase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000325	0.999635	CS pos: 17-18. Pr: 0.9777

TMHMM  Annotations     

There is no transmembrane helices in VBB82090.1.