CAZyme Information: VBB81906.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB81906.1
• CAZy Family: GH55
• CAZyme Description: Putative Glycoside Hydrolase Family 47

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
971	LR026968|CGC14	109409.56	5.8436

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026968:3871489-3874469(-)

Full Sequence      

MFRLRRYRVFLICAFVITVLLYHVSKNSQWDRTQEIWHTSTRHGETKVETKPAEKAQAPV
VAKPPVVKEDPAVVEVKPPAPKVQVEEKPTPEVVDDHDHDHGHGDTPVKIPSLKEESKEK
GSYDLPTKPPPLKGTHEKEQPPKDKSTTPATIPDRLPGSGIGSHNHENTPSKPDLEITST
TAIHWTKPSEWFPIPPESIIPLPTGKPKPIPTIQAKFEPETPQAREKRELRLAKVKAETQ
RAWQGYKIYAWTHDELRPVSKAYHDPFCGWAATLVDSLDTLWIMGLKSEFEDALKAVAEI
DFTTTPYRTDIPVFETIIRYLGGLIAAYDISGMKKEYKVLLDKAEELAEILMSVFDTPNR
LPILYYQWHPAYNIAPKRAAQNAGVAELGSMSMEFTRLAQLTGENKYYDAVARITDAFEE
LQNWKGRGRSAIEGIFPEHLDASGCNRSAPWPPVDQQEREDGRVDLGVVGVDGLGVVGGT
GVKVQRRDEVVRGDDGVGGRDQMTPGRPGKKKLPDGFECAPQGLVSSNAWGSYGMGGSQD
SAYEYFPKQYLLLGGLVPKYKTMHEKTVAAVKKHLLFRPMAKGDPDILFSAKATSKDGTA
DSLDYEWEITHLTCFLGGMFGLGGKIFESPEDVEIGKKLAEGCFWAYDVMPTGIMPEYAK
IMPCKSATDCKFNETAWHEQLDYRASYRAQEMERYYESKAAWKEQVEEIKKEQALQKERV
EKAKEEAARRPVAKSNANSDTGAGSDQKTEPKQPVQQQQQQQEEKPQAREGSFPSRFQRR
QLNGTFNKPRGADLQNSLDLNSAPVTNTNTRDDDWATAYSDNDDSQIPLTELTLPPEPIK
PMTHEEYIADRLKNEIIPPGFTSLNDKRYILRPEAIESVWYMYRITGDPKWQEKGWKMFE
SVIKHTQTEVGHSAIRDVTAKGDAGGMDDSMESFWLAETLKYFYLLFAEPEVVSLDEWVL
NTEAHPFRRPT

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	240	969	2.6e-184	0.9932735426008968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	3.01e-168	240	969	3	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	6.84e-78	164	970	5	519	glycoside hydrolase family 47 protein; Provisional
223039	PHA03307	4.29e-05	59	225	41	209	transcriptional regulator ICP4; Provisional
411408	PspC_subgroup_2	1.29e-04	51	234	296	483	pneumococcal surface protein PspC, LPXTG-anchored form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site. The other form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A.
178748	PLN03209	4.63e-04	109	225	322	443	translocon at the inner envelope of chloroplast subunit 62; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB81906.1|GH47	0.0	1	971	1	971
CAP64664.1|GH47	0.0	301	971	1	673
AEO60003.1|GH47	0.0	1	971	1	898
AEO67971.1|GH47	3.82e-316	1	971	1	882
QBZ62321.1|GH47	4.30e-264	1	970	1	1024

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KKB_A	3.94e-38	218	967	13	465	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	4.58e-38	218	967	11	463	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
2RI8_A	2.43e-34	235	671	9	354	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
5KIJ_A	3.07e-34	242	657	16	326	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	3.22e-34	242	657	16	326	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0D076|MNS1B_ASPTN	1.16e-37	217	968	25	506	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|B8N417|MNS1B_ASPFN	9.51e-37	214	968	24	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2
sp|Q2ULB2|MNS1B_ASPOR	9.51e-37	214	968	24	507	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1
sp|P45700|MA1A1_MOUSE	2.15e-36	218	967	188	640	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Mus musculus OX=10090 GN=Man1a1 PE=1 SV=1
sp|O02773|MA1A1_PIG	2.97e-36	192	966	175	643	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Sus scrofa OX=9823 GN=MAN1A1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000012	0.000017

TMHMM  Annotations     

Start	End
7	24