CAZyme Information: VBB81475.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB81475.1
• CAZy Family: GH47
• CAZyme Description: Putative GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637		68696.84	7.1472

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026968:2601965-2604054(-)

Full Sequence      

MLLSWLSFTAAVASAARIPPRQSQQPNHVLEEFVNRLRNLIPDSLGGLTPVLGTSTEYEY
VVVGAGTAGTTLAVRLAQSGARVALVEAGSYYDLTNPIISSTPGLDVLLIGSDPLNSNPL
VDWNFVAKNQPGTNFRDIHFARGKCVGGSSALNFMIYQRPTVQSMQLWADSVNDSSYTFS
NTLPYFQKSVQFTPPNMNKRFANSTPGYNAAAFPATSNNPLHVSFANYAQSFSTWLKAGF
ATIGIGETPDFNSGSLMGAQYCTSTIRPVDQTRSSSASSFLKTALVNNLFNLKVYTATRA
EKILFNSNKKATGVRVKTGLVSYTLSASKEVIISTGAFHSPQLLMVSGIGPADQLQAHNI
PILSNLPGVGQNMWDHPTFGPSYPVDLITLTKEARDPIYLAEQLVQYKTNQSGTLTNPVA
DFLAWEKIPPPLRQTQFSPSTQAKLAQFPPDWPEIEYISGAGFVGDFSNFLLVQPSDGRQ
YATILNVLNTPLSRGNVTITSASTADLPVINPAWLTDRADQELAVAAYKRARQAFTSSGL
APIVAGEEAYPGPGVQSDGEILEAIRNSLMTLWHPACTCKMGREGDPMAVLDSKARVRGV
SGLRVVDASSFPILPPGHPQSTVYMLAEKIADDILQG

Enzyme Prediction     

No EC number prediction in VBB81475.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	57	636	8.4e-179	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.46e-100	54	635	2	532	choline dehydrogenase; Validated
225186	BetA	9.21e-95	57	635	7	534	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	8.36e-44	491	630	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.53e-26	53	637	51	579	Protein HOTHEAD
366272	GMC_oxred_N	1.75e-24	133	378	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB81475.1|AA3_2	0.0	1	637	1	637
CDP29676.1|AA3_2	0.0	1	637	1	637
QKX64780.1|AA3_2	2.01e-237	46	637	30	614
QQK43083.1|AA3_2	9.65e-237	58	636	34	605
UCK58435.1|AA3_2	2.01e-235	57	637	42	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NCC_A	8.02e-54	34	631	5	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
7AV4_AAA	2.05e-53	34	631	65	633	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	2.20e-53	49	631	1	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	3.04e-53	49	631	1	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	4.18e-53	49	631	1	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	8.91e-183	45	634	39	624	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	5.95e-178	8	634	8	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	2.07e-171	45	635	23	608	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	1.42e-160	55	637	38	610	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q0CJ60|ATC_ASPTN	5.19e-139	44	635	25	594	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.528684	0.471307

TMHMM  Annotations     

There is no transmembrane helices in VBB81475.1.