CAZyme Information: VBB81264.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB81264.1
• CAZy Family: GH45
• CAZyme Description: Putative Glycosyltransferase Family 50

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
443	LR026968|CGC4	49755.45	9.9810

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026968:1934329-1935734(+)

Full Sequence      

MTKPSATGQPEPPATSSSGAFSLVTTFFDRPLPLYLSAAIFRLVFLLYGLWQDANSPVKY
TDIDYLVFTDAARFVSQGQSPYERETYRYTPVLAWLLLPTAHVTGNRILDVAFFSFGKVL
FAISDLVAGWLLEKVLAKSMDAPRARKFATIWLLNPMVATISTRGSSEGLLGVLVMALLW
AVLERRVTLAGLLLGFSVHFKIYPFIYAPAIVWWMDNERMSPNKTKPTSISSKPPSLTAK
ILNFITPPRLQLALISLTTFSTLNIAMYLIYGTPFLQETYLHHVTRLDHRHNFSPYNTQL
YLSSSLPLSSSSSFRIEKLAFLPQLLLSTVFIPLVTAKKSLPTSMLVQTFAFVTFNKVCT
SQYFLWYMVLLPLYLPQSSFVKNKRFGLAALVLWVVAQGAWLQQGFELEFLGNSTYLPGL
WLASLAFFAVNCWILGVIIGDVR

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	161	439	3.3e-99	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	1.41e-87	34	439	11	415	GPI mannosyltransferase
252941	Mannosyl_trans	7.71e-71	161	439	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB81264.1|GT50	1.03e-316	1	443	1	443
CAP65259.1|GT50	4.30e-309	1	443	1	443
CAD60578.1|GT50	4.30e-309	1	443	1	443
CDP29471.1|GT50	4.30e-309	1	443	1	443
QBZ54528.1|GT50	2.96e-199	10	442	4	427

PDB Hits     

VBB81264.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7S4Z3|GPI14_NEUCR	8.52e-206	6	441	2	484	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	2.27e-180	28	441	7	407	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	4.13e-179	24	442	1	410	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q5B7W0|GPI14_EMENI	2.96e-176	26	442	3	428	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q4WAH2|GPI14_ASPFU	5.20e-175	24	442	1	421	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999996	0.000006

TMHMM  Annotations     

Start	End
32	51
111	133
161	183
190	212
250	272
319	336
351	373
385	402
417	439