CAZyme Information: VBB81197.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB81197.1
• CAZy Family: GT90
• CAZyme Description: Putative protein of unknown function

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
737	LR026968|CGC7	80471.02	7.7576

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026968:1773612-1775825(-)

Full Sequence      

MMMVTPRCFSRATLVLLSVILSLLLFTALRVHNGIPPTVSITAAQSMVENLAGEWFHLDR
QHPAKVSPFTPQADNAAEEPKPPELPVEGKSSRNLARPPELEYLRQEKFGLTDTILYTQQ
CIKPVYDKTVDRNLVSNITTPFTSDKSTIGLTLSDENLSLPPCTPISLPVSKPYPQTPHP
ELIFGVASTYERLSSESTLSAFAHWLSHSKSRLILTITDYHSLPSPSASSSSLLKLYHSR
SILVSALPPPPPPAHTKNYTTPQLHFLLLSTLLSFSTPQTTFLSLIDDDTFFPSLHRLSV
ALGRYDPSVPLYLGARSESKSANRQYGEMAFGGAGLFVSVPLARQLVPYFERCAVEYGGR
DRGGDGLLRDCVYGFTEVRLTEVRGLWQGDLRGDVSGFFEGGRVGRREGERRGGGEGKYL
DPWHNPGIPRRDHKRVKREERGGGAAGDGERGGILTHGRTLGFHQEIPNSSAGRREAVVL
LVAEVPEGGGGERRGRTEAVVLLGGGGLENGTTLPSLPATFNTSLGKKEAVVALMGEALE
NGTTPPSPPAYGSPSPASSTEQPTPPTPIPNTSPHPTSSALETTPPPPPLLSLHHYKTWF
HAPIPQMSAITSLCGDCFLQRFKTGCNTTTTSSSSSSTVGLWVNGYSYTEFPPGSFPDLQ
KVEATWQYASSGDYDEAYGPLRPRLGEGQKKQWLLVDAYWTGEGKRKKQFRQLYIYRAPR
GGDKKPVDEVLEVVWDV

Enzyme Prediction     

No EC number prediction in VBB81197.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	8.29e-10	278	399	209	328	hypothetical protein; Provisional
367085	Fringe	1.16e-07	285	353	90	166	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
398362	DUF604	1.27e-05	328	398	8	76	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB81197.1|GT31	0.0	1	737	1	737
AEO67880.1|GT31	2.62e-67	80	736	37	512
AEO60093.1|GT31	6.72e-67	2	737	1	539
QBZ53356.1|GT31	1.11e-58	73	736	52	510
CEI69250.1|GT31	8.03e-54	99	737	54	492

PDB Hits     

VBB81197.1 has no PDB hit.

Swiss-Prot Hits     

VBB81197.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000009	0.000040

TMHMM  Annotations     

Start	End
7	29