CAZyme Information: VBB80802.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB80802.1
• CAZy Family: GH3
• CAZyme Description: Putative GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
613	LR026968|CGC33	64918.15	5.4709

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026968:673929-675825(+)

Full Sequence      

MDSEHDFIIVGGGTSGLVVAARLTEDPNTSVLVVEAGTEHTNDPRIRTPAFWLSVLGSPD
FDWAYKTVPQKGLDGKVIPLSQGKLIGGSSAINGLAFVANSKAAVDAWGAFGNPGWDWET
LGPYYKKFHTLAHPSDAAGKHLRLSYVDESVRGCDGPIKASFPEESNDPLPNAWVDTIGA
LGFPASGDPFSGKFSGGYVNALSVDPESRTRSDAATAYFEPAKSRPNLHVVTSALAEKIL
FDTAGASPKAVGVQIQKDGKTVTLTAKKEVILAAGVFGSPKLLELSGVGNRELLEKLNIP
VVVDNPNVGENLQDHPVSSVSFEVEEGVKTIDALTRQDPEAVGAAMQEYMTNKSGPFAVG
NFTGSLLPVADFVGPDGKSTLDQVIKQITASNPSPSSGDFTPHHTEFVHSVLANRAEGAG
NLFMYAACANVNPDSVGADIIVKDASPANFVTICAALCYPLSRGSAHITSSNAADLSVID
PRYLEHPLDLEVQARLLRYAETIVRTEPLSKFIKRGGRRNAGAPADLGDLDLAKQYSKLS
ALSCWHPTSTCAMLPRERGGVVDAQLHVHGVEGLRIVDASIIPLATRGNTQTTVYAVAER
AADLIKKEYGIGN

Enzyme Prediction     

No EC number prediction in VBB80802.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	4	607	8.5e-183	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	8.09e-105	1	606	2	532	choline dehydrogenase; Validated
225186	BetA	2.66e-98	1	608	4	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.58e-35	460	601	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.59e-34	74	317	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.55e-27	2	594	53	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB80802.1|AA3_2	0.0	1	613	1	613
CDP29061.1|AA3_2	0.0	1	613	1	613
QKX53653.1|AA3_2	9.35e-222	4	608	6	610
ANH22750.1|AA3_2	5.32e-212	3	606	42	642
UPM17946.1|AA3_2	8.40e-183	4	611	7	616

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.35e-87	3	608	4	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	3.88e-85	3	609	4	586	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	3.23e-73	4	608	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.41e-72	3	608	1	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	2.14e-68	4	609	40	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	9.45e-101	1	609	10	620	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A142PTM2|CITC_MONPU	4.39e-98	1	612	10	615	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	4.39e-98	1	612	10	615	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.02e-95	6	608	41	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.60e-79	4	605	46	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000005

TMHMM  Annotations     

There is no transmembrane helices in VBB80802.1.