CAZyme Information: VBB80613.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB80613.1
• CAZy Family: GH2
• CAZyme Description: Putative Glycoside Hydrolase Family 93

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475	LR026968|CGC7	51630.05	5.7440

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026968:137124-138552(+)

Full Sequence      

MSHLLGSPCACLLLPENASNRWPSRRTGLLPLSYLPRTTHRHKAPVTVTESATNSELLSA
LFLHHFSPPTNSLTHHPRHVRVVTLCLFPSRSPRSLPNMAGYLLSKLGFDLKNQADNHDP
GNNDDRLPPLPQLHISTEDHFPPSTQGTYPRLCQLSDGSLLKSYTTFGPDGERVLVVSRS
VDQARSFEVVGEITRSHGDCDNCFLAELEPGVVLAAFRNHDLSGEDGNKPTWFRITVCRS
RDGGRIWEYLSQAVEKGGSDGVWEPFVRIPVGRREEVQLYYSAEAEQGQRQDTMVVVSGD
GGETWSEPRKITGEEGLRDGMVGIAGMKDAVSGKEAMVMVLETTRCGPGRFSIEAVVSYD
EGLSWASRQEVYKPFGEGKNAGAPQIGTLAGGEGVAVVFMTDEDGNEGVWPSGAKIKTVL
GVGLGNGVINWSREADTVFEEGSSWPGILGVGHGEALVVCETRSRIGGRLLSLDL

Enzyme Prediction     

No EC number prediction in VBB80613.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	146	409	9.1e-65	0.8794788273615635

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	3.16e-13	153	340	151	336	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.15e-07	205	365	19	186	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB80613.1|GH93	0.0	1	475	1	475
CDP28900.1|GH93	0.0	1	475	1	474
CAP61824.1|GH93	0.0	1	475	1	474
AEO68654.1|GH93	3.07e-99	132	471	7	366
CAP92687.1|GH93	9.75e-95	126	461	27	349

PDB Hits     

VBB80613.1 has no PDB hit.

Swiss-Prot Hits     

VBB80613.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000001

TMHMM  Annotations     

There is no transmembrane helices in VBB80613.1.