CAZyme Information: VBB80356.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB80356.1
• CAZy Family: GT58
• CAZyme Description: Putative protein of unknown function

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458		48100.86	5.9057

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026967:3202386-3203824(+)

Full Sequence      

MLSSTSTLVLLGGLFSAVAAGKPASVVKARDGLTPSFPYDPNTTSQCFWWADITSATTCD
TIIRDNYITLEELRRWNPSLASTSGCTLQVGRSYCVEAIDDSEPSPGPSSTSTSSTTGVS
SALTSSSSTVVVTTSTSSSSTVALPVTTTKPGNGITTPTPTQATIVDNCDAFHFVTAGQT
CEVVASLYRISQDQFKAWNPSVGASCTGLWANAYACVSIIGHEPSPTTPGNGITTPTPTQ
ATIVNNCDEFYFVTSGDTCESVAAKHGITQAQFLSWNPSVGSTCSGLWANAYACVSIIGH
TPTKPTTTTSAGNGIATPTPIQPNMVKNCDLFYKVKSGDTCAAIAASKGITVAQFTSWNP
YVGSGCTLLWLDYYVCISIVGHTPTPVNPGNGIQTPTPYQDGMTSSCKTFHFVQSGQTCQ
TITQRYGITQANFVRWNPAVKNDCTGMWANAYVCVAVL

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	1.14e-09	332	375	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	1.03e-08	250	288	2	40	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	4.10e-08	332	377	1	44	Lysin motif.
212030	LysM	8.10e-08	409	448	1	40	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
182727	mltD	6.95e-07	333	443	346	437	membrane-bound lytic murein transglycosylase D; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB80356.1|CBM50	0.0	1	458	1	458
VBB80752.1|CBM50	3.18e-258	1	458	1	436
CEF84338.1|CBM50	6.03e-126	29	458	26	440
CZS72050.1|CBM50	8.53e-126	29	458	26	440
CAE7022339.1|CBM50	5.12e-116	35	458	30	451

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PXV_A	3.41e-07	333	378	5	48	Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],4PXV_B Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],4PXV_C Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],4PXV_D Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_A Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_B Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_C Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis],5YLG_D Crystal Structure of LysM domain from pteris ryukyuensis chitinase A [Pteris ryukyuensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	3.43e-145	16	458	14	458	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4B4P8|LYSM2_ARTBC	1.99e-18	257	386	39	188	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AVW3|LYSM5_ARTBC	8.83e-18	216	457	223	536	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4AZ68|LYSM3_ARTBC	4.99e-17	236	379	254	408	LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01488 PE=3 SV=1
sp|D4B5F9|PGDA_ARTBC	6.02e-11	322	379	380	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000354	0.999642	CS pos: 20-21. Pr: 0.9728

TMHMM  Annotations     

There is no transmembrane helices in VBB80356.1.