CAZyme Information: VBB80335.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB80335.1
• CAZy Family: GH18
• CAZyme Description: Putative Glycoside Hydrolase Family 18

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1363	LR026967|CGC4	148709.43	5.4913

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026967:3141910-3146122(+)

Full Sequence      

MKAFLCALVATGAAGALANDVSSSALSHPVLNARGVEDELDKWLSAVQAQPIEALQSCPI
SCRKAGEDPWYLFPDVSQLTSCNETMLLNMVVQMAEDKETPTVIRACTADYDTSGSVKAA
FMPDETRASLCTTANKVLEVTSVHIHHPGKAGDFSVNHLLSAGRQVKSYLASQKPSCTNN
AIAFGYSQTSLIGLFAGAEVHQHGVTSDVLDAFLKHAQDKSISGTTVVQLCGAKNRGADY
SIGIVASSAKNLELVQEVVKTWADGKCVSQAGVGVDWMTVTLRVPSPVEELSRNGTISNG
TSTSHQSSPRDLVSRSARLSPRADCRFTTVQADEGCFAVAGRCGISQTQLASYNRKDLCQ
SLILGERVCCSSGTLPSTLPPGNSDGTCKTRQVVLGDDCGSLANKCGISGDDFTKANPQS
SLCSTLAEGQHVCCSQGKLPDLRPKKGADGYCAVYKTKRDDNCAKIAASNMLTVTELENF
NKNTWGWSGCKLLYPDFNMCVSDGAAPMPAIVPNAMCGPTMNGTVRPPVGTNISTLNPCP
LNVCCNIWGQCGMTDDFCVISKSETGAPGTSAPGKSGCVSNCGRDIIKGSTPPARFKLGY
FEGWNFNRECLTMDASQIDTDTYTHIHFAFPNVTRGDFRIEITDPLVKEQFEAFKQLQGV
KKIVSLGGWDFSALPGTFDILREAAQPRNRDVFKRNIISFINEHNLDGIDLDWEYPGAPD
IPDIPADDPVNGLNYYRLLVSIKQEVGTSKTVSFAAPASFWYLRAFPIKQMAEALDYIVF
MTYDLHGQWDAGNKWTSPGCPSGSCLRSHVNETETKDALSMITKAGAPSNKILVGVTSYG
RSFKMAQAGCDGENCLFTGDNRNSQAAKGRCTAFSGYIANAELDEIIASGRVNKRYTKEG
SNIMVYDDTEWVAWMDDEMKAKRTEFYHSHNFLGTTDWAVDLQEWMDGSGSITDDTEDKL
IYEELPACTGQYTTLKQLEDRKGSIPSHCLEQYIVDVQVAIFDGALKKYQKLIDDGYDKK
FSVWEGYVKEQIPGQIKNFMATDKVDKYFKCGEMKTVTCCDTCTNAWCGAACERFAGCKN
GKQMVPRDKCPRVEFDPEPGFNSKHPNTTFTLTDRDGFFKDIFDTWGIEKDWIRFAKRQM
SLANGCQFLDADKVRDCINWNSIHFHEFPTMDSGKVKLSNPKDVITEALPGAQDLLNRYR
DMKVFAEFEHDIEMSDLTDAGSLPAFAVEEAVAQMDKIVEEAKEIEKRRREEFILNMIMG
FLFFIPFIGPTGGGLIATSVRGLLTLIGVAGEVGVAVYSVVKDPDNAFTTVVGTLLGMGF
SRGGFRGAANTRRGMSSTEYNSLGNIKPKLDTIGNLRGGMCAL

Enzyme Prediction     

EC	3.2.1.14:3	3.2.1.14:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	599	943	1.2e-47	0.9222972972972973

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119357	GH18_zymocin_alpha	0.0	597	943	2	345	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
214753	Glyco_18	1.02e-55	597	942	2	333	Glyco_18 domain.
395573	Glyco_hydro_18	4.45e-49	599	941	4	305	Glycosyl hydrolases family 18.
119365	GH18_chitinase	6.51e-40	599	844	3	267	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119351	GH18_chitolectin_chitotriosidase	3.46e-36	600	942	4	340	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB80335.1|CBM18|CBM50|GH18	0.0	1	1363	1	1363
CAP66963.1|CBM18|CBM50|GH18	0.0	1	1363	1	1363
CDP28705.1|CBM18|CBM50|GH18	0.0	1	1363	1	1363
VBB80751.1|CBM18|CBM50|GH18	0.0	1	957	1	963
CAP61951.1|CBM18|CBM50|GH18	0.0	1	957	1	963

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WL1_A	3.25e-31	600	945	12	361	Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with reaction products (GlcNAc)2,3 [Ostrinia furnacalis],3WQV_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)5 [Ostrinia furnacalis],3WQW_A Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain in complex with a(GlcN)6 [Ostrinia furnacalis]
3WKZ_A	7.97e-31	600	945	12	361	Crystal Structure of the Ostrinia furnacalis Group I Chitinase catalytic domain E148Q mutant [Ostrinia furnacalis]
3WL0_A	1.95e-30	600	945	12	361	Crystal structure of Ostrinia furnacalis Group I chitinase catalytic domain E148A mutant in complex with a(GlcNAc)2 [Ostrinia furnacalis]
3W4R_A	3.00e-30	600	945	30	379	Crystal structure of an insect chitinase from the Asian corn borer, Ostrinia furnacalis [Ostrinia furnacalis]
6JM7_A	7.39e-28	600	945	9	352	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P09805|KTXA_KLULA	1.33e-108	383	965	188	737	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|P36362|CHIT_MANSE	2.06e-29	600	945	28	377	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
sp|Q95M17|CHIA_BOVIN	1.96e-28	600	945	27	367	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
sp|Q13231|CHIT1_HUMAN	2.64e-26	600	945	27	365	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|Q6RY07|CHIA_RAT	2.88e-26	600	954	27	373	Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000376	0.999618	CS pos: 18-19. Pr: 0.9590

TMHMM  Annotations     

Start	End
1253	1275
1282	1301
1306	1325