CAZyme Information: VBB80096.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB80096.1
• CAZy Family: GH18
• CAZyme Description: Putative Carbohydrate Esterase Family 8

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	LR026967|CGC27	36138.24	9.1354

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026967:2297115-2298184(-)

Full Sequence      

MHLLLLLLPLLGLIPSTAAQSRTTPPSSSCIRVSKTPSAHSAQFSTLSSAITSLSTTSTS
PVCIFLYPGTYQEQVLIPAAVKSPISIYGSTTNSASYTSNSVTITQSKSQANTGASNDET
GTVRVKANNVKIYNLNIVNSYGKGSQAVALSAYADSGYYGCSFQGYQDTVLANRGKQYYS
RCEIVGVTDFIFGQESPAWFERCDIRVLSSSVGYITASGRSNSASPNFYVFNNCNIAAKS
GQSVNNGAFYLGRPWREYARVVFQNTAMSGVVNGAGWRIWNAGDERTSNVYFGEYANSGP
GAGGTRASFARRLGGPVAIETVLGGDYKGQGWFDGNYGM

Enzyme Prediction     

No EC number prediction in VBB80096.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	40	311	3.2e-75	0.9097222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	1.78e-44	62	332	41	291	putative pectinesterase
395871	Pectinesterase	5.92e-44	41	303	9	267	Pectinesterase.
178372	PLN02773	8.48e-43	32	313	5	282	pectinesterase
178113	PLN02497	3.18e-39	62	335	62	328	probable pectinesterase
215367	PLN02682	6.15e-39	18	313	60	347	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB80096.1|CE8	3.16e-215	1	339	1	339
CAP66743.1|CE8	5.36e-198	1	339	1	321
CDP28478.1|CE8	5.36e-198	1	339	1	321
QBZ62655.1|CE8	2.54e-109	6	337	4	324
QGI88211.1|CE8	7.69e-107	11	337	7	328

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	8.66e-50	20	337	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	1.22e-49	20	337	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1XG2_A	6.62e-16	44	303	15	270	Chain A, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.42e-14	41	302	16	273	Pectin methylesterase from Carrot [Daucus carota]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	2.87e-72	16	337	14	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	2.49e-64	19	337	17	329	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	8.33e-57	41	337	41	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	8.33e-57	41	337	41	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	1.82e-55	1	337	1	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000187	0.999769	CS pos: 19-20. Pr: 0.9673

TMHMM  Annotations     

There is no transmembrane helices in VBB80096.1.