CAZyme Information: VBB79973.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB79973.1
• CAZy Family: GH16
• CAZyme Description: Putative Glycoside Hydrolase Family 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
925	LR026967|CGC3	100270.08	6.8221

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026967:1901940-1904926(+)

Full Sequence      

MVKLDGDLDPLWQDLDWAIGQMVIMGWDGTEVTPQIRHLIEEHHLGSILLTAKNLKSAHQ
TAKLVQELQTIAHQAGHLQPLLIALDQENGGVNSLYDEDYICQFPSAMGQAAAGNADLAY
KVAKATATEVSAVGVNLILGPVLDVLTNARYQPLGVRAVGDDPQEVSQYGIAAMNGYKDA
GMATCGKHFPSYGNLDFLGSSLDVPIITQTLEELSLSALVPFRNAIATGKLDAMFVGGCG
ITNPSMNVNHACLSDQVVDDLLRNELGFTGVAISECLEMEALRSEIGVKTGTVMAVEAGC
DLVLLCRAYDVQLEAIAGLKLGVENDLLTKERIYTSLRRVLKMKNACTSWAKALNPPGIS
LLSKIHPSHLNLSIKAYDDSITVIRDNEKLLPLNESMHQEEELLLLTPLVKPLPASSLTK
NILEAKNKSDSAPSEHDKWIHRDRGVIMSGEGVFRELGRSLARARRGKLLHTSYTANGVR
PVHENLIHRASCIVIVTADANRNLYQAGFTKHVSMMCSMLRASGQKKSLVVVAVSSPYDF
AMDKSIGTYICTFDFTEMAMAALVRALCGSSRARGTLPGTLRKSRKAVKSRQHWLVEPYD
RDRDSNGLNDLLSALARAAAPNHRFLTTTTAHSFEIFNPNIEESHFVVRNSSTQALYGFC
ATYHTQGTGIIGAIFVDPTKRNVAIGRSLHRRALRALIQKRGTKKIQLGICFPGVFLGIP
TDDGGLKTWFSNSGWDLQFPRRLANMVIADLSSWSAPEGLLQSIQRANMSFDLIHGLENA
ETVLTHVAGNANPEVFELYRLALQETKSCGVVRAKCQRGGLVGTVIICSPGSPVAGYVPA
LQGGEEVLVGGIIAPVVAPGNGDLLVIQGLALMGLRQNKAHKSGRSVLSWVGEEGMEGLG
AMGWEVLEGWEEFTNSVENVSFLEG

Enzyme Prediction     

No EC number prediction in VBB79973.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	80	304	5.2e-49	0.9490740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	5.94e-65	19	396	7	353	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	9.48e-51	15	341	2	314	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	3.34e-37	22	330	3	304	beta-hexosaminidase; Provisional
178629	PLN03080	2.32e-05	104	396	114	418	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB79973.1|GH3	0.0	1	925	1	925
CAP66618.1|GH3	0.0	18	925	38	898
CDP28353.1|GH3	0.0	18	925	38	898
AEO64229.1|GH3	0.0	1	921	1	927
AEO58968.1|GH3	0.0	1	919	1	922

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	2.48e-83	14	781	8	723	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	1.69e-57	15	581	13	531	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	4.46e-33	15	578	44	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	6.47e-33	15	578	18	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	8.26e-33	15	578	48	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	2.30e-32	15	578	44	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	4.59e-29	29	319	12	296	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|Q82SJ8|NAGZ_NITEU	5.03e-29	29	319	12	296	Beta-hexosaminidase OS=Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) OX=228410 GN=nagZ PE=3 SV=1
sp|P48823|HEXA_PSEO7	1.58e-28	30	396	49	428	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|B2FPW9|NAGZ_STRMK	1.08e-27	22	322	1	296	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

There is no transmembrane helices in VBB79973.1.