CAZyme Information: VBB79958.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB79958.1
• CAZy Family: GH16
• CAZyme Description: Putative Glycoside Hydrolase Family 5

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
842	LR026967|CGC24	94494.03	9.4782

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026967:1864311-1866902(-)

Full Sequence      

MPRDPSTDREARGERRRSTHHGHHRNRSSAKHDRDGDRDRETDAEREERRRKRRSQSRRP
TSTPRGAGGGNESDAPSSSQGLSAAALAQLNKANAKDKAKSRSRPTSRQPEQRRRSSRAP
APEPEIRDARDLALEWERSRGKGRFAPPEDSEDAEREARRAARRAARTRERSRAAGYESV
GQGGYESGEPPERERRRGRKGYEKVDGGGGGLAPKVITVAGPSGERYERDRTTKGGRRVV
SGAQLEEGIENVQSRKPHRSGLRGGGFMGMNFGVSSEDSMLRAKPQETESELWRGKPRPW
YKQKKKLWWLIGVCTVLLIIIIIVAAVVVPNSGKDENKRDDGSGGGGSGGKSNLGSISPD
SIPKDAPSYLNPFVWASTDDFNLTYTAETVGDLPLMGLFTSWDDSARANDKVPPLNKPWG
DYTKRPARGVNVGGWLSLEPFITPSLFDYDSRFGIVDEYTLCSYLASRCASVLEAHYASF
VTESTFRDIAAAGLDHVRIPFSYWAVQTYEGDPYLFRTSWRYLLRAIEYCRKYGLRVNLD
PHGLPGSQNGWNHSGRLGAINWLNGTEGDLNARRSLEFHDRLSRFFSQPRYRNVISHYGL
ANEPKMTELSVPAVLEWTAQASSTIRKNGIPEDVILVFGDGFRGLGNWQGELQSLPNAAL
DVHQYVIFNEEQIAYNHSQKIRFACEGWARQTRESMDRSTGFGPTLVAEWSQADTDCAKH
LTNVGWGNRWTGTLGPGGTRPKDLRPRCPALDRTCSCEEANAGPERWSDGYKRFLRMFAE
AQMDSFEKGWGWFYWVWDTEDAAQWSYKKGMAAGVLPQKAYEREFNCDLSKIPSFSDLPE
TY

Enzyme Prediction     

EC	3.2.1.58:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	476	800	5.2e-99	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.34e-43	421	836	12	403	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	2.28e-06	479	665	23	195	Cellulase (glycosyl hydrolase family 5).
381626	GH113_mannanase-like	4.95e-05	477	611	16	131	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB79958.1|GH5_9	0.0	1	842	1	842
CAP66605.1|GH5_9	0.0	1	842	1	845
CDP28338.1|GH5_9	0.0	1	842	1	845
AEO58846.1|GH5_9	5.00e-299	215	842	165	785
CAB91690.2|GH5_9	4.50e-281	354	842	415	903

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	4.27e-60	421	825	3	387	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
2PB1_A	1.31e-59	416	825	5	393	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
1CZ1_A	2.13e-59	421	825	3	387	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
3O6A_A	2.43e-59	416	825	4	392	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PC8_A	3.43e-59	416	825	5	393	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CTI3|EXGD_ASPCL	3.17e-195	352	842	345	830	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgD PE=3 SV=1
sp|Q2UMV7|EXGD_ASPOR	5.77e-193	352	842	345	831	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgD PE=3 SV=2
sp|B8NNK9|EXGD_ASPFN	5.77e-193	352	842	345	831	Probable glucan 1,3-beta-glucosidase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgD PE=3 SV=1
sp|Q4WMP0|EXGD_ASPFU	1.22e-192	350	842	345	833	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgD PE=3 SV=1
sp|B0Y7W2|EXGD_ASPFC	1.22e-192	350	842	345	833	Probable glucan 1,3-beta-glucosidase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000000

TMHMM  Annotations     

Start	End
307	329