CAZyme Information: VBB79534.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB79534.1
• CAZy Family: GH13
• CAZyme Description: Putative Polysaccharide Lyase Family 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231		24109.18	7.3840

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026967:578738-579602(+)

Full Sequence      

MFSNAGQIALTLLAAAPTALACLGYTGGLPKATGNVALTAPIYVKAGQVYDGGWRKFDRN
PSSCNGQSEGGEKDTAFVVERGGTLRNVIIGKTVGEGVYCKGGGCNLEFIWFEDVCEDAI
SIKDDRPGDVTNIIGGGAYHASDKVIQHNGCGRVNVSIINFYAENYGKVYRSCGTKCARE
VYVEGVTARKGGEVVGITKANGDKATLVNVCTDAKTPCQNYSGPGAKDGAC

Enzyme Prediction     

EC	4.2.2.2:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	33	223	6.5e-77	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	1.06e-90	26	224	1	196	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB79534.1|PL3_2	1.16e-172	1	231	1	231
CDP27896.1|PL3_2	1.52e-154	1	231	1	239
CAP61540.1|PL3_2	6.36e-152	1	231	1	241
UPK92652.1|PL3_2	5.93e-138	7	231	4	228
UQC76789.1|PL3_2	3.33e-131	1	231	1	231

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	3.51e-21	42	174	9	135	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	9.93e-19	34	187	6	152	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	1.01e-18	34	187	7	153	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	8.75e-18	34	187	15	161	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4Z05_A	8.75e-18	34	187	15	161	C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725],4Z05_B C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CCF8|PLYF_ASPTN	1.38e-91	1	223	1	219	Probable pectate lyase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyF PE=3 SV=1
sp|B8NJZ7|PLYF_ASPFN	1.96e-91	1	223	1	219	Probable pectate lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyF PE=3 SV=2
sp|A1D5E3|PLYF_NEOFI	1.06e-88	17	223	13	219	Probable pectate lyase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyF PE=3 SV=1
sp|B0Y953|PLYF_ASPFC	3.03e-88	17	223	13	219	Probable pectate lyase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyF PE=3 SV=1
sp|Q4WKV8|PLYF_ASPFU	1.00e-86	17	223	13	219	Probable pectate lyase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000412	0.999566	CS pos: 21-22. Pr: 0.9655

TMHMM  Annotations     

There is no transmembrane helices in VBB79534.1.