CAZyme Information: VBB79507.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB79507.1
• CAZy Family: GH13
• CAZyme Description: Putative Carbohydrate Esterase Family 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294	LR026967|CGC19	32078.66	7.7863

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026967:502722-503713(+)

Full Sequence      

MKTCAGEPSTQIDRSLRLHQATQDSGHKLWEGDKKADLLALLAPIHYDHLLKQAPQSFKM
QLSNLLTIALAGLAAASPVELVERQQKLRIMPLGDSITEIACWRAFVWDQIAAAGFANQV
QYVGSQNSNPQGCRPTTTNWDQRHEGHSGWLAIDIANNYLANWLRSTPADIVQFMLGTND
VFRGRSTNDIIAAYTKMVQIMRAANPKMKIIVDLVIPLGVGSNSGIQALNARIPAWAAGL
NTTESPIVIADCNTGYKTSDLRDGVHPSIAGDQFLATKIGPPLLNYIRESLAGN

Enzyme Prediction     

No EC number prediction in VBB79507.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	88	277	1.9e-52	0.9639175257731959

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	3.10e-43	88	283	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	3.35e-15	93	271	2	173	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	3.38e-11	93	281	4	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238866	sialate_O-acetylesterase_like2	7.40e-10	166	237	46	120	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238872	SGNH_hydrolase_like_2	5.45e-08	89	276	3	185	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB79507.1|CE3	3.95e-216	1	294	1	294
CDP27869.1|CE3	1.88e-214	1	294	1	294
CAP61514.1|CE3	1.88e-214	1	294	1	294
AEO64701.1|CE3	6.70e-132	63	292	5	235
AEO59370.1|CE3	1.21e-120	62	291	4	233

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B5S_A	9.63e-65	88	289	2	205	Crystal structure of a carbohydrate esterase family 3 from Talaromyces cellulolyticus [Talaromyces cellulolyticus]
5B5L_A	2.73e-64	88	289	2	205	Crystal structure of acetyl esterase mutant S10A with acetate ion [Talaromyces cellulolyticus]

Swiss-Prot Hits     

VBB79507.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999847	0.000183

TMHMM  Annotations     

There is no transmembrane helices in VBB79507.1.