CAZyme Information: VBB79385.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB79385.1
• CAZy Family: GH125
• CAZyme Description: Putative Glycoside Hydrolase Family 93

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
461		50919.32	6.9454

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026967:151696-153081(-)

Full Sequence      

MHVYIPLSQPLFLIYVREQGQFHFRVRDSLSLFTHTLHSLGFRKAFSFVNTAIHYLITMI
TYFFLSVLLHLLLSPLPLIAATPLLPPRSPPPTLSFNPISPPILIHPNAVYPRATTLFNL
SSPTPDSPLLLTSYTTTHHSNGLKTLSASTSSHHPTQTWTFLSHIWTANASTHEIDNPFA
LQLPNGNMLYAFRNHDIDPLTRKYTYYRITLCVSTDFGRTWEFLSHASERAAKKENNGLW
EPFLRVDGRGRVQIYYSSERGVNRQDNMLRVSGDGGRTWGEEVLVSRAGEGEESRDGMVG
VAEVGGEEEGRLVCVFETTTEEEGGRRFAVGLVESFDDGETWGQGTRRRVYTARKGKDAG
APQVVSVGGVLVVSFMTNEGVSESEGGEGVDGGEMKIVLSRDGGRRWEGVGDGNGEGERA
AVAAGRGSHWPGLFRLDDRRFLGLYSANGAGAVSRVFEIKG

Enzyme Prediction     

No EC number prediction in VBB79385.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	107	385	3.8e-75	0.8827361563517915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	4.35e-07	157	457	57	334	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.50e-06	178	342	17	186	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
404074	BNR_2	9.35e-05	150	360	86	264	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
271234	Sialidase_non-viral	0.001	268	343	48	126	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB79385.1|GH93	0.0	1	461	1	461
CDP27766.1|GH93	0.0	1	461	1	461
CAP61411.1|GH93	0.0	1	461	1	461
UKZ63990.1|GH93	4.11e-80	102	459	37	360
QYS95310.1|GH93	6.63e-79	102	459	37	361

PDB Hits     

VBB79385.1 has no PDB hit.

Swiss-Prot Hits     

VBB79385.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999942	0.000079

TMHMM  Annotations     

Start	End
52	74