CAZyme Information: VBB76866.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB76866.1
• CAZy Family: CE4
• CAZyme Description: Putative mannan endo-1,6-alpha-mannosidase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489	LR026966|CGC1	54375.03	4.9140

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026966:868239-869900(+)

Full Sequence      

MLSTVVLALAITSTRAALNVDLDSADSIRFAAGLVASKLMDYYHGEEPGQTPGILPGPPP
AGPYYWWEGGALWGTMVDYWHYTHSQLYNDLTLRALVYQANPPHNDYMPPNWTASLGNDD
QGFWGMSAMLAAETTFKNPPPGQPQWLALAQAVFNTQAERWDTRYCNGGLRWQIPLSNNG
YNYKNSIANAIFFNLGARLARYTNNRTYAEWAGKTWDWMEGVGYIDKENWNVYDGGHVEG
NCTDINRAQFSYTAAIFVQGCGFLYNYTNGEQKWRDRLEGLTNRTLNNFFLSQPKAGTRP
AAMEPSCELEERNQCTTDMLSFKGYLHRWMAQTTQMAPFVRGFVMPVLRESVRSMAESCL
PDGTCGFRWNRGQYDGNTGAGQQMNALGALVSLLVEQPEVKEAVTAKNGGTSAGDPNAGR
EGEVGEWEGESEVITDADRVGAAVVTILMVGTVMGMMIWVSVTTGEEEEYARVMRGEKKK
GKGRVIERT

Enzyme Prediction     

EC	3.2.1.101:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	24	407	3.2e-103	0.9664804469273743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	4.24e-160	27	387	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB76866.1|GH76	0.0	1	489	1	489
CDP26767.1|GH76	0.0	1	489	20	508
AEO67877.1|GH76	8.36e-180	1	466	12	469
AEO70851.1|GH76	3.63e-178	10	459	14	451
AEO60096.1|GH76	1.52e-177	10	467	18	470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.20e-145	22	419	30	425	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q75DG6|DCW1_ASHGO	9.15e-114	6	459	11	448	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|O74556|YCZ2_SCHPO	1.95e-113	7	419	9	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|P36091|DCW1_YEAST	1.55e-108	17	459	21	446	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	7.96e-105	18	459	19	443	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q05031|DFG5_YEAST	1.12e-98	17	459	26	455	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000285	0.999689	CS pos: 16-17. Pr: 0.9714

TMHMM  Annotations     

Start	End
440	462