CAZyme Information: VBB76690.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB76690.1
• CAZy Family: CE3
• CAZyme Description: Putative GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645	LR026966|CGC11	69944.77	6.9161

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026966:351266-353203(+)

Full Sequence      

MFLQRVLALGAACASLSLVCAVDLTGYEYVVVGSGAGGGPLAARLALAGHKTLLIEAGDD
QGQSINYTVPAYHARVSEDPKLAWNFFVRHYADDERQARDWKTSYDTPDGTIYSGLNPPE
GSKMKGVLYPRTGSLGGCTSHNAMVAVYPHESDFNYISTLTGDSSWRPDNMRKYFARMER
KQYINGLYKGHGRDGWFTTEVAPLTIPLKDPQLLATLTGGASALGSLSNQILNVGTLLAG
DLNADSSLRDRQPAYYQIPISTDKGTRLGTREFVVSVRDAKNPDGSKKYPLDVRLNCHVT
KVIFDKKSSPPRAIGVEFLDGAYLYRASPLSTGAKGTPGSARASREVILAGGTYNSPQLL
KLSGIGPKDELKSFNIPVLVDLPGVGANLQDHYETAVTARAPRSYNALKDCTFLFNTTDD
PCLDKWQRPILGDRGTYASNGFAAAMLSKSTTTPDGSFDTFVFGGPVNFHGYYPGYSYAA
VAESDLWTWAVLKAHPRNTAGFVRLRSADPLDVPEINYNYFDTGSGDWRADIQTIVEGIE
LAREALRKQPVRTNEILPGAGTNTREELEAYIKDTSWGHHASSTCPIGPDGDPMAVLDSK
FRVRGVKGLRVVDASVYPRIPGTFTAVSTMMVAEKAADDILAEAN

Enzyme Prediction     

No EC number prediction in VBB76690.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	26	642	2.6e-97	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.85e-75	41	641	20	532	choline dehydrogenase; Validated
225186	BetA	8.37e-68	41	644	22	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.49e-35	501	636	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	9.58e-24	291	643	235	579	Protein HOTHEAD
366272	GMC_oxred_N	5.76e-15	127	394	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB76690.1|AA3	0.0	1	645	1	645
CDP26593.1|AA3	0.0	1	645	1	645
BCS21087.1|AA3	0.0	1	641	1	640
EAA61171.1|AA3	0.0	1	643	1	642
QMW33146.1|AA3	0.0	1	645	1	646

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	1.37e-49	27	637	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	1.89e-49	27	637	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	1.89e-49	27	637	8	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	1.89e-49	27	637	8	557	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	2.42e-49	27	637	24	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6LGH5|BETA_PHOPR	1.13e-48	25	641	3	531	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|A0A248QE08|FAP_CHLVA	2.88e-48	27	637	84	633	Fatty acid photodecarboxylase, chloroplastic OS=Chlorella variabilis OX=554065 GN=FAP PE=1 SV=1
sp|Q7MF12|BETA_VIBVY	8.40e-47	27	641	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q8BJ64|CHDH_MOUSE	6.95e-46	19	640	35	573	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q8D3K2|BETA_VIBVU	1.44e-45	27	641	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000702	0.999277	CS pos: 21-22. Pr: 0.9588

TMHMM  Annotations     

There is no transmembrane helices in VBB76690.1.