CAZyme Information: VBB76413.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB76413.1
• CAZy Family: CE1
• CAZyme Description: Putative Glycosyltransferase Family 8

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
299		34473.02	5.6300

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026965:4609368-4610267(+)

Full Sequence      

MPSVYTTLITSLSYLPGLLTLHHSLVHRSKSKYPLIALYTSSFPQLGLAILRRRNIPCQL
ITPLFPSSSSSSNTPSYSHDPRFRECFTKLIPFSLVQYKKIIQLDSDMLVLRNIDSLFDI
ELDSDKRVFAASHACLCNPCQFEHYPDYFRPENCYYTDPTSMGKDYLNGGLQVVRPDLGV
YEEIVGYMNTPGIDLSFADQSVLAGCFRDRWVGLGWEFNALKTMRWRGVHDDVWGDGEVR
NVHYILTPKPWEEERDEKGRVVMGAGERGAEDKVTSQWWVDVDDERREREEERGIRDGW

Enzyme Prediction     

No EC number prediction in VBB76413.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	5	253	6.9e-40	0.8715953307392996

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	1.51e-57	4	279	2	234	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
133037	GT8_A4GalT_like	1.07e-14	90	251	88	246	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
279798	Glyco_transf_8	3.44e-11	14	251	10	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
215090	PLN00176	6.14e-11	14	284	35	293	galactinol synthase
227884	Gnt1	1.32e-08	80	223	150	320	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB76413.1|GT8	3.04e-227	1	299	1	299
CDP26326.1|GT8	1.97e-223	1	299	1	299
CAP73925.1|GT8	1.97e-223	1	299	1	299
CZS78946.1|GT8	9.98e-98	2	297	14	319
CEF75665.1|GT8	9.98e-98	2	297	14	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MW5_A	8.44e-14	3	253	8	241	UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Platinum [Globisporangium ultimum],6MW8_A UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Manganese [Globisporangium ultimum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q947G8|GOLS1_SOLLC	2.06e-15	14	251	32	253	Galactinol synthase 1 OS=Solanum lycopersicum OX=4081 GN=GOLS1 PE=2 SV=1
sp|C7G304|GOLS2_SOLLC	3.35e-15	26	285	47	295	Galactinol synthase 2 OS=Solanum lycopersicum OX=4081 GN=GOLS2 PE=2 SV=1
sp|O22893|GOLS1_ARATH	6.29e-13	14	285	42	302	Galactinol synthase 1 OS=Arabidopsis thaliana OX=3702 GN=GOLS1 PE=1 SV=1
sp|Q9FXB2|GOLS2_ARATH	8.05e-13	14	285	34	294	Galactinol synthase 2 OS=Arabidopsis thaliana OX=3702 GN=GOLS2 PE=1 SV=1
sp|Q9FFA1|GOLS5_ARATH	2.67e-12	26	284	45	293	Galactinol synthase 5 OS=Arabidopsis thaliana OX=3702 GN=GOLS5 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999985	0.000040

TMHMM  Annotations     

There is no transmembrane helices in VBB76413.1.