CAZyme Information: VBB76009.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB76009.1
• CAZy Family: CBM52
• CAZyme Description: Putative Glycoside Hydrolase Family 31

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
989	LR026965|CGC10	111786.47	6.2657

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026965:3295483-3298522(-)

Full Sequence      

MHLLGPLSGRWTAYLGLISTLSGVITPAVAVKEHDFKKCAQSGFCSRNRALADHVLSTNS
WSSPYSILPESGSFKDGQYQAVVLKTINDNGDTVRLPLTVSFLESGTARVTIDEEKRQKG
EIELRHDSKARKERYNEAEKWVIVGGLTLDKEAKVDFEDKSQLTVKYGPTSNFEAVIKFA
PFGIDFKRDGVSQIKFNDQGLLNVEHWRPKIEKPAVENKDTSEGEQNQEDKEEEEPKGED
ESTWWDESFGSNTDSKPRGPESVGLDITFSGFEHVYGIPSHTGPLSLKTTRGGDGSYSEP
YRLYNADVFEYILDSPMTLYGSIPFMQAHRKGSSVGVFWLNAAETWVDITKGKDSKNPLS
LGIGSKTSTHTHWFSESGLLDVFVFLGPTPKDLTAKYGELTGTTTMPQEFAIGYHQCRWN
YVSDEDVKDVDRKMDKFKMPYDVIWLDIEYTDDKKYFTWDEHSFRDPIGMGKQLESHGRQ
LVTIIDPHIKNTDNYPVVAELKSKDLAVKNKDGNIFEGWCWPGNSHWIDAFKPAAREWWA
TLFKYASFKGSMENTWIWNDMNEPSVFNGPETTMPKDNLHDGNWEHRDVHNLNGMTFHNA
THHALKTRKPGELRRPFVLTRAFFAGSQRIGAMWTGDNTAEWGHLKESIPMILSQNIAGF
PFSGADVGGFFGNPDKQLLTRWYQAGAFYPFFRGHAHIDARRREPYLMGEPYNTIIAGAL
RLRYSLLPSWYTAFHQAHVDGTPIVKPLYYTHPDEEAGFPIDNQFFVGNTGLLVKPVTEE
NKETQDIFIPDNEVYYDYFTYNVVASGKAGKTVTVAAPLEKLPLLMRGGHIFPRRDIPRR
SSQLQKWDDYTLVLTIPKDGKHAEGELYVDDGDSYDFEQGQYINRRFVYDGAAKTITSVD
KEGRDTKSVKQGEWLKKYNGVRVDKIVVVGAEEKVWGKKTEVNVVDESGKGAWKAKVEFT
PADKAAGRASFAVIKRVGASIGSDWKVEL

Enzyme Prediction     

EC	3.2.1.20:27	3.2.1.84:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	383	831	5e-151	0.9929742388758782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269889	GH31_GANC_GANAB_alpha	0.0	402	874	1	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
395838	Glyco_hydro_31	0.0	383	831	1	441	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
224418	YicI	3.43e-175	258	935	138	772	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269890	GH31_glucosidase_II_MalA	4.30e-143	402	741	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
269888	GH31_MGAM_SI_GAA	2.84e-115	402	738	1	367	maltase-glucoamylase, sucrase-isomaltase, lysosomal acid alpha-glucosidase. This subgroup includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase. MGAM is one of the two enzymes responsible for catalyzing the last glucose-releasing step in starch digestion. SI is implicated in the digestion of dietary starch and major disaccharides such as sucrose and isomaltose, while GAA degrades glycogen in the lysosome, cleaving both alpha-1,4 and alpha-1,6 glucosidic linkages. MGAM and SI are anchored to small-intestinal brush-border epithelial cells. The absence of SI from the brush border membrane or its malfunction is associated with malabsorption disorders such as congenital sucrase-isomaltase deficiency (CSID). The domain architectures of MGAM and SI include two tandem GH31 catalytic domains, an N-terminal domain found near the membrane-bound end, and a C-terminal luminal domain. Both of the tandem GH31 domains of MGAM and SI are included in this family. The domain architecture of GAA includes an N-terminal TFF (trefoil factor family) domain in addition to the GH31 catalytic domain. Deficient GAA expression causes Pompe disease, an autosomal recessive genetic disorder also known as glycogen storage disease type II (GSDII).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB76009.1|GH31	0.0	1	989	1	989
CAP73528.1|GH31	0.0	1	989	1	995
CDP25931.1|GH31	0.0	1	989	1	995
AEO56295.1|GH31	0.0	1	988	1	981
AEO62724.1|GH31	0.0	6	988	6	990

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DKZ_A	0.0	31	987	5	948	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DL0_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5DKX_A	0.0	31	987	5	948	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DKY_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5JQP_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
7KRY_A	1.61e-241	13	989	11	942	Chain A, Neutral alpha-glucosidase AB [Mus musculus],7KRY_C Chain C, Neutral alpha-glucosidase AB [Mus musculus]
5IEF_A	1.06e-239	31	989	1	911	Murine endoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]
5IEG_A	1.10e-239	31	989	1	911	Murine endoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9US55|GLU2A_SCHPO	5.27e-276	34	958	29	910	Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gls2 PE=1 SV=1
sp|Q94502|GANAB_DICDI	5.44e-253	30	933	23	900	Neutral alpha-glucosidase AB OS=Dictyostelium discoideum OX=44689 GN=modA PE=3 SV=1
sp|Q4R4N7|GANAB_MACFA	4.62e-243	10	989	11	943	Neutral alpha-glucosidase AB OS=Macaca fascicularis OX=9541 GN=GANAB PE=2 SV=1
sp|Q8BHN3|GANAB_MOUSE	2.33e-240	10	989	11	943	Neutral alpha-glucosidase AB OS=Mus musculus OX=10090 GN=Ganab PE=1 SV=1
sp|Q14697|GANAB_HUMAN	4.64e-240	10	989	11	943	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.278685	0.721312	CS pos: 30-31. Pr: 0.6815

TMHMM  Annotations     

There is no transmembrane helices in VBB76009.1.