CAZyme Information: VBB75741.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB75741.1
• CAZy Family: PL42
• CAZyme Description: Putative Glycosyltransferase Family 31

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
583	LR026965|CGC19	67138.70	8.2039

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026965:2595107-2596921(-)

Full Sequence      

MTLSDFVRGLFGEPPNPSPSHPPQPLPQTANPYANIAQGSGWTPRRRRSTRRFLPRPLRR
AIRFLKSNWLSFPLFAIVCFLLGAAVLPYDSTLRLGVRWNWKRLVTGGRPSEEWVLRERP
EYEVDWGRDVGVVLKTGYGTRGRVPAWFESVRGWEEVVVIADYGGEMVLGDGGERVVKVY
DMVERGLENPILGGLLGHKRVGKYERLTAAVGAKDEELAGGLSKEFGWELDALKFIPGLE
FAYQRWPDKKWYLLVDDDTFLVETSVKRFLGHFDPEEKHYLGNAVGDFRARFAHGGSAVI
LSQAAMRALVKENPKALKTSYLESLDEVWGDRLLAKALIRVGIYLDERYAYLFNGEPPRR
SKIRGDRMCSPILSFHTLPQPEMMRDVGEHFRNVTEPVFWLDLWKIYGVAAPWRWDPEMT
KKTIKDPKQREEMSRIVLRDVKSEWECLAEYNRRFRASTRTGWAWGKPEPDACVIFRSAP
PFESEVDAWTLDWDYVGPVDEAVYTHENVASAQDCMEKCTEKAFKKCIAWTWESSTGRCH
VSPWMIVGEEVKEQDKVSGFNIRRVRKLERECPTFDGYESRRD

Enzyme Prediction     

No EC number prediction in VBB75741.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
394981	PAN_1	1.47e-04	508	560	21	73	PAN domain. The PAN domain contains a conserved core of three disulphide bridges. In some members of the family there is an additional fourth disulphide bridge the links the N and C termini of the domain. The domain is found in diverse proteins, in some they mediate protein-protein interactions, in others they mediate protein-carbohydrate interactions.
367085	Fringe	0.001	247	309	83	159	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
214680	PAN_AP	0.002	501	543	16	57	divergent subfamily of APPLE domains. Apple-like domains present in Plasminogen, C. elegans hypothetical ORFs and the extracellular portion of plant receptor-like protein kinases. Predicted to possess protein- and/or carbohydrate-binding functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB75741.1|GT31	0.0	1	583	1	583
CAP73256.1|GT31	0.0	86	583	1	498
AEO62992.1|GT31	2.50e-142	86	572	45	473
AEO56549.1|GT31	2.37e-135	76	572	313	740
QMW46572.1|GT31	1.19e-108	74	572	16	445

PDB Hits     

VBB75741.1 has no PDB hit.

Swiss-Prot Hits     

VBB75741.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999981	0.000041

TMHMM  Annotations     

Start	End
67	89