CAZyme Information: VBB75677.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB75677.1
• CAZy Family: AA9|CBM1
• CAZyme Description: Putative Glycoside Hydrolase Family 63

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
832		94274.38	4.7976

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026965:2403874-2406429(+)

Full Sequence      

MIPNWRRLLAATALLTSTTTVTATIDAAAPSNNDESILYSELASQQNSSLLWGPYRPNLY
FGVRPRIPKSLMTGLMWGKVESFQDFQNTMRYTCEQNEGMKGYGWDEYDARNGGVQTIHD
RGNGLTLTTSFVKVPGGRNGGSWGARVKGVLGDPEQRTTVILYVTQEGGGRLEAERGEEK
RGYEGDVVLSGESEGLGGYKLVVTKGEGERPTSTHEISELEAWGEGGRTTVQSLQYPDEQ
IWQAKPIVFRQLKEQVDWLVENKYDNAEHAPPVWQVFTLQNRPGKGNVHIVQKVFEGDFE
FDVLFSSESAGTELKSEDLTREIKAGSEEFGERFGGVFALKAPFNADKYKKFGRSMFSNL
IGGIGYFYGQAVVDRSYAPEYDEVDEGFWEEAAEARARHAEALEGPHELFTSVPSRPFFP
RGFLWDEGFHLLPIADWDTDLALEVIKSWFNLIDEDGWIGREQILGAEARSKVPQEFQTQ
YPHYANPPTLFLVVEQFVERLLNTNGTAAVHKERLSQSESLANASLENPEVGLDYLRKIY
PLLRRQFQWFRKTQKGDIKSYDREAYSTKEAYRWRGRTTTHCLTSGLDDYPRPQPPHPGE
LHVDLMSWVGLMAKSLSNIGDALGFAEDVNEYRTILDAIEHNLVDLHWSETDGCFCDATI
DDFEENKLVCHKGYISLFPFLTGLMKPDDPKVGRILALIGDEEELWTPYGLRSLSKKDAL
YETAENYWRSPIWININYMAVKQLHYVATQDGPHKEVARDLYSRLRKNLVETIYNAWEET
GFAWEQYNPDTGKGQRTQHFTGWTSLVVKIMTMEDLEGGAKATGSEHGRDEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	600	811	6.6e-30	0.43157894736842106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	314	813	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	1.22e-105	50	271	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	6.85e-11	533	745	358	549	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
283786	GDE_C	6.14e-06	534	798	104	365	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB75677.1|GH63	0.0	1	832	1	832
CDP25594.1|GH63	0.0	1	832	1	832
AEO63368.1|GH63	0.0	27	832	33	831
AEO56870.1|GH63	0.0	27	832	30	838
CAC18158.1|GH63	0.0	28	832	30	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	5.37e-186	47	811	12	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	7.37e-134	50	814	37	778	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	1.13e-227	41	812	33	805	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	2.71e-185	39	811	34	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	2.37e-135	50	814	92	833	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	1.82e-129	52	814	94	833	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|F4HTM3|GCS1_ARATH	2.46e-126	29	812	92	846	Mannosyl-oligosaccharide glucosidase GCS1 OS=Arabidopsis thaliana OX=3702 GN=GCS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.037232	0.962739	CS pos: 27-28. Pr: 0.7535

TMHMM  Annotations     

There is no transmembrane helices in VBB75677.1.