CAZyme Information: VBB74023.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB74023.1
• CAZy Family: AA9
• CAZyme Description: Putative Glycoside Hydrolase Family 76

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397		43843.46	6.8269

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026964:8428600-8429793(-)

Full Sequence      

MVSTTWGGLAARALFYMSIHRLGHAATDAPYAENAELAAKVLQDWFKPQTGGWSTGGWWQ
NANILTVLTDWALLEGPNQHVNVTDIAVTTFVNAQKENVQIGKRHRADERMASSRKHTRT
TESGYPKFINTFYDDEGWWALAWIRSYDLTKKIEYLSMAESIFDDMRTGADNVCGGGILW
NKTMRYKAAIANELYLTVAASLANRVQGSKDHYLQIAREQWVWFKKSGLINKDNLINDGL
NSTTCLNNNETTWSYNQGVILGGLVELSKAAGNDSYLSPAVDIAEAAIASLQDEDGILHE
ADHCDMRADCGEDGPQFKGIFIRNLHYLYKAVPNEKFAMTIKKNADSIWAKGRDPKTNRL
GLSWVGKPEAGIGPTAKTHSSAMDALVAAMGVVAGSK

Enzyme Prediction     

No EC number prediction in VBB74023.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	33	390	2.1e-93	0.9329608938547486

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	6.38e-32	130	364	83	330	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	4.65e-13	92	335	56	284	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	0.002	248	369	22	122	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
395616	Glyco_hydro_9	0.007	133	220	211	287	Glycosyl hydrolase family 9.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB74023.1|GH76	3.16e-299	1	397	1	397
CAP67367.1|GH76	6.85e-294	1	397	1	397
CDP24780.1|GH76	6.85e-294	1	397	1	397
EAA32525.1|GH76	5.40e-129	1	390	1	415
AEO70866.1|GH76	3.45e-122	1	393	1	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K7X_A	6.78e-18	129	372	87	322	Chain A, Lin0763 protein [Listeria innocua]
4MU9_A	1.06e-13	132	369	116	343	Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
6SHD_A	2.19e-13	127	368	128	367	Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	4.01e-12	127	368	129	368	Chain A, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	2.27e-11	127	368	129	368	An inactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q05031|DFG5_YEAST	8.08e-12	134	325	122	325	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.869441	0.130557

TMHMM  Annotations     

There is no transmembrane helices in VBB74023.1.