CAZyme Information: VBB73951.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB73951.1
• CAZy Family: AA8|AA3
• CAZyme Description: Putative GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
677	LR026964|CGC21	72502.25	6.3396

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026964:8178481-8180869(-)

Full Sequence      

MDLTAFLVAILFSACLQAVDGLLVPANKFIDLALPSYDYIVVGGGVSGLVVANRLTENKN
VTVLVLEAGDLDSGPDLVTIPGLVGHGFVPSQNWNITTTPQESLDNRTRDYGQGHVVGGG
SILNGLVMTRGARYDYDAWRTLGNPGWSWHGMLRYFKKSENFTACVAPEDSQNLHIRPHM
KVHGQKGPLQVGYPKFFYNSSRNFLEGISELGIPLLPDINTGIAAGASIAPATINDRNQS
RADSRRAYLDSVLSRPNLHLATQQTVTRVLFGTEAVDEDSKRPAKGLKRAFGVERMACDR
EVILAAGAIISPSLLQVSGIGPASVLDELGVPVHIDLPGVGQNLQDHAMVGAFYNYTRSG
MFTANNLTGSILEEVESQYFANRTGPLTHPLISTLAFASLRHLDTNWETLLSNITSSEPE
SHLPPGPGQHPTILKGYARQQHLLTSLLARSSVGALEVMADSIGTLTAAVQHPLSRGFVR
ALSADLLANGSVARNILLDPRYCSHPFDCDIIVRGLKLNNQLVKTKAMQQLVPQPAYPWD
DLTSQNDTALLEAVHSKLQTEFHPAGSTSMLPLEFGGVVSPRLMVYGTSNLRVIDAGIIP
LLPAAHIQAAVYAIAEKAADIIKQDSSTMSGSSPNDGDVTPPPNPFTNGPPGLGPGIAEG
PGVAGRVNDDHGRPYQS

Enzyme Prediction     

No EC number prediction in VBB73951.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	36	625	3.5e-170	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	4.04e-81	52	626	23	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.46e-74	36	623	5	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.78e-30	473	618	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.14e-28	103	347	13	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.09e-12	257	611	234	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB73951.1|AA3_2	0.0	1	677	1	677
CDP24709.1|AA3_2	0.0	1	617	1	617
UPK94759.1|AA3_2	8.27e-177	37	623	37	606
QSZ30071.1|AA3_2	3.12e-175	34	635	34	633
APA13089.1|AA3_2	7.40e-175	34	630	34	631

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	6.47e-98	36	625	5	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	6.79e-82	6	625	3	641	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
4YNT_A	3.76e-76	36	628	5	570	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	9.84e-69	37	625	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	5.22e-68	37	625	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	2.45e-97	37	623	38	614	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	1.70e-90	31	622	41	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.70e-90	31	622	41	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A2H3D1U1|ARMD5_ARMGA	6.13e-73	36	625	39	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	1.89e-68	36	624	40	609	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000364	0.999592	CS pos: 21-22. Pr: 0.9753

TMHMM  Annotations     

There is no transmembrane helices in VBB73951.1.