CAZyme Information: VBB73902.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB73902.1
• CAZy Family: AA8|AA3
• CAZyme Description: Putative Glycoside Hydrolase Family 76

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460	LR026964|CGC30	50322.30	5.1515

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026964:7981607-7983039(-)

Full Sequence      

MRFVKYVRPVAVPAVIISAVAPKELNISDSLSIKGVAKTVAANAMSYYSGTPEKFVDLPQ
PYYWWQAGALMGSMLDYSHYTGDHSYDKLIARGLLDQVGPDFDYMLPTHFGQEGNDDQAF
WGMSVMAAAERNFPQPDPNVPGWLDMGANIFDSLAGRWNTTACQGGLLWQIFASNPNGLD
YKNTVSNGGFFQIAARLARATGNKTYSDWAEKVWDWTEAIGMIDKFGNVYDGAHASKDCK
DTNPVTFSYSASIYIYGAAVMADVTQDKKWTERTERMVEASRSFFSPFENATNIMYEHAC
EQVNKCNQDMRSFKAYFSRFVYAAARYVPSIKPAIEELWHTSVEAAAKTCTGGASGTQCS
HKWYTGAFDGNPGLGQEMSALETIQGLLALDAEAPLKGGEIKTVRAFADQNAVKGDSETA
SGPAPTPTSESDSAPGSQTEAGTQTSGALRRRTVPVKGWW

Enzyme Prediction     

No EC number prediction in VBB73902.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	31	391	2e-92	0.9329608938547486

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	2.60e-157	32	381	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	5.94e-05	45	288	29	251	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB73902.1|GH76	0.0	1	460	1	460
CDP24660.1|GH76	0.0	1	460	1	460
CAP67249.1|GH76	0.0	1	460	1	460
AEO60662.1|GH76	1.00e-233	1	407	1	407
AEO70787.1|GH76	2.68e-229	1	408	1	408

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	5.89e-90	37	395	40	410	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FLP9|DCW1_CANGA	2.50e-101	24	395	20	389	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	2.17e-100	24	395	23	392	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	1.30e-99	25	395	24	394	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q5AD78|DCW1_CANAL	1.86e-96	25	395	21	395	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|Q5ACZ2|DFG5_CANAL	2.13e-88	18	403	17	404	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.973766	0.026263

TMHMM  Annotations     

There is no transmembrane helices in VBB73902.1.