CAZyme Information: VBB73724.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB73724.1
• CAZy Family: AA7
• CAZyme Description: Putative Carbohydrate Esterase Family 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
586	LR026964|CGC3	63527.06	4.8903

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026964:7525290-7527311(+)

Full Sequence      

MWPAEAVIGAISTLLSLQADHVAPGFISSNSTPSWHTSLAKRAAQDFFLRVMPLGASITE
GIGSRNGVGYRDLLRAQLRTRGWNVNMVGSKQNGRFEDNDNEGHPGLTINQVRGEFNEIG
KALMPNLVLLNAGTNDCIRQIDTNNAGARLKALIDDVFTTVPGVTVVVSTLAPSRKNDSC
SADLSQQYRDLVTNTYRGNPRIGMADLHAAININDHLHPDGVHPNDAGYAIFASLWMEAI
RKLEDQIQPPAAVIDDGPADVQRPSPPNDKECIRTPGTVVDGTYLHEQVERGILSSAKIP
KRVDGREATPSQILFANVVVMNNLFKRGEELDDRIAVYRGGDGGNSYVLSQNRAGGNFET
NTMEFSVGIDCDVSKGARVIFADFNNDGLDDFFCVNAKAGVSVSLNRGGRPPRFESIGQV
VPDREGFTADDVRVAQIDGDGRADYCLIKADSSIDCIRQNEQGEFNGALQLTFDKLSGID
KGRVVLGDINGDFRSDYLRIGENGNILAFINSGMGSNNAPEWRDAGIITQGGLGIMPPEL
IKFGRVFGSSKLDYIYLDENGGNFEVHAWQNTGKGGKVRVTEDCPP

Enzyme Prediction     

No EC number prediction in VBB73724.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	49	240	3.6e-57	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	5.38e-30	49	240	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	2.70e-14	54	231	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	6.81e-12	54	239	4	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238872	SGNH_hydrolase_like_2	2.73e-07	50	239	3	191	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225353	TesA	3.26e-07	54	246	14	214	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP24531.1|CE3	4.93e-274	1	384	1	384
CAP67115.1|CE3	4.93e-274	1	384	1	384
CCT73237.1|CE3|GH43_30	4.36e-140	44	582	74	629
AEO70515.1|CE3	4.67e-112	37	576	91	624
UDD56943.1|CE0	1.30e-81	39	576	46	592

PDB Hits     

VBB73724.1 has no PDB hit.

Swiss-Prot Hits     

VBB73724.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.994081	0.005925

TMHMM  Annotations     

There is no transmembrane helices in VBB73724.1.