CAZyme Information: VBB73265.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB73265.1
• CAZy Family: AA7
• CAZyme Description: Putative protein of unknown function

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436	LR026964|CGC49	48759.83	6.9326

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026964:5925243-5926608(+)

Full Sequence      

MLSLSKLAVLGLGLISQASAVILQNGQVRETNFPNTRLDSFSPSSYRTYPANASEISYKG
RWDSKYVSWWSAPGIKFGYTGQTVAITFGNLTTDRVLVGYRIGGLDWIFTNITAGATHLL
VSPETPGSSLTGPINPWTFELRVSNWAYGIQIDSVHVAKGEKLIKIPEHGRRIEVIGDSL
SAGMYTTYEGLTSWAYGLGAGLGNTEYSVTGYPGICAADQDCWGNPRGQVHQWFYTSDTS
WRASQIWGDNPEPWDFSKQPAADIVVINIGTNDHNQHNNVSTEAYIDALGKIIQGVHGKW
PKAQVIVMSLWLGFYQQGNTYLPNAPEGWVKEIQDLVKYFNSDKYLSQPVIYDGVTKKST
KLRVKRKESPFVHWFNTKGILQHNDIGPQWHPTDVGAIKVASHLQQFIRIKFGWELEATG
PEVWHETLYWNDESGY

Enzyme Prediction     

No EC number prediction in VBB73265.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	172	408	6.7e-19	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	1.03e-34	172	409	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	8.13e-11	173	407	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	3.01e-10	175	338	1	134	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
395531	Lipase_GDSL	7.85e-07	173	404	1	224	GDSL-like Lipase/Acylhydrolase.
238874	FeeA_FeeB_like	2.80e-06	169	307	1	111	SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it turn are loaded onto the acyl carrier protein FeeL. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB73265.1|CE0	0.0	1	436	1	436
CDP24093.1|CE0	0.0	1	436	1	436
CAP67836.1|CE0	0.0	1	436	1	435
AEO54717.1|CE0	3.00e-275	1	436	1	433
EAA35351.3|CE0	3.63e-262	1	436	1	432

PDB Hits     

VBB73265.1 has no PDB hit.

Swiss-Prot Hits     

VBB73265.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000357	0.999620	CS pos: 20-21. Pr: 0.9732

TMHMM  Annotations     

There is no transmembrane helices in VBB73265.1.