CAZyme Information: VBB72853.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB72853.1
• CAZy Family: AA4
• CAZyme Description: Putative Glycosyltransferase Family 66

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
746	LR026964|CGC15	83554.08	8.3620

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026964:4707637-4710157(-)

Full Sequence      

MSAETLEILADVGKGKSTRSVLRVIILALIAGASIASRLFSVIRFESIIHEFDPWFNFRA
TKYLVANGFYNFWDWFDDRTWHPLGRVTGGTLYPGLMVTSGAIWHALRAFTIPVDIRNVC
VLLAPAFSGLTAIAAYLLTNEMTTYNSAGLLAALFMGIAPGYISRSVAGSYDNEAIAIFL
LVFTFYLWIKALKQGSMLWGAFCALFYGYMVASWGGYAFITCLLPLHAFVLILMGRYSTR
LYVSYTTWYALGTLASMQIPFVGFLPVKTSEHMPALGIFGFLQLLAFLDYVRSAIPSRQF
QTFLWIFAGGIFVLSLAALVIATSAGIIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPT
AWPAFFFDLNLLIFVFPVGVYLCFQELADEHVFIIVYAVFGSYFAGVMVRLMLTLTPVVC
VAGAIAISTILNNYLVAKTPTEEDQQAAEAAEKKGSKSGLKSTNKPVVGIYGLWSKILMV
GAMAIYLLIFVMHCTWVTSNAYSSPSVVLASRMPDGSQHIIDDYREAYQWLRQNTKEDAK
IMSWWDYGYQIGGMADRPTLVDNNTWNNTHIATVGKAMSSREEVSYPIMRQHEVDYVLVV
FGGLLGYSGDDINKFLWMVRIAEGIWPDEVSERAFFTPRGEYRVDGEATETMKNSLMYKM
SYYNFNNLFPPGQAVDRMRQARLPEVGPSLSTLEEAFTSENWIIRIYKVKDLDNVGRDHI
SATAFEKGLKKKKATKKRGSRVLRVD

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	22	667	2.8e-192	0.8513708513708513

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	8.72e-149	21	503	1	478	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	1.29e-113	21	717	18	737	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
275016	archaeo_STT3	2.06e-29	24	558	1	547	oligosaccharyl transferase, archaeosortase A system-associated. Members of this protein family occur, one to three members per genome, in the same species of Euryarchaeota as contain the predicted protein-sorting enzyme archaeosortase (TIGR04125) and its cognate protein-sorting signal PGF-CTERM (TIGR04126).
224720	ArnT	0.002	73	326	49	282	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
404170	PMT_2	0.007	122	236	26	135	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB72853.1|GT66	0.0	1	746	1	746
CDP23733.1|GT66	0.0	53	746	118	811
CAP64953.1|GT66	0.0	53	746	118	811
AEO65709.1|GT66	0.0	1	746	1	747
AEO54301.1|GT66	0.0	1	746	1	750

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C26_A	1.08e-311	19	717	13	690	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
6S7T_A	8.75e-281	24	739	76	807	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6FTG_5	1.04e-266	20	716	16	701	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	2.09e-266	20	716	16	701	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6FTJ_5	5.74e-264	20	711	16	696	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94335|STT3_SCHPO	0.0	22	732	24	738	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
sp|P39007|STT3_YEAST	5.56e-311	19	717	13	690	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
sp|E2RG47|STT3B_CANLF	2.24e-280	24	739	76	807	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
sp|Q8TCJ2|STT3B_HUMAN	4.50e-280	24	739	76	807	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1
sp|Q3TDQ1|STT3B_MOUSE	5.75e-280	24	714	73	774	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Mus musculus OX=10090 GN=Stt3b PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999991	0.000001

TMHMM  Annotations     

Start	End
21	43
85	107
119	138
148	168
175	192
212	234
241	263
273	295
307	329
362	384
391	409
414	436
467	489