CAZyme Information: VBB72132.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB72132.1
• CAZy Family: AA3
• CAZyme Description: Putative mitochondrial cytochrome c peroxidase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355	LR026964|CGC20	39553.70	8.3921

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026964:2469945-2471069(+)

Full Sequence      

MASATRTFARALRTSARPAINAAPRAAFRQSARFYSAKPTGGSSSNGLLYGLAGAGLLGG
GAFYLYNNDSNVAPKLFVPKFEDYQKVYNEIASRLEEKEDYDDGSYGPVLVRLAWHASGT
YDKETGTGGSNGATMRFSPESDHGANAGLKAARDFLEPVKAKFPWITYSDLWILAGVCAI
QEMMGPTIPYRAGRQDRDVAACTPDGRLPDAAQAQDHLRNIFYRMGFNDQEIVALCGAHA
LGRCHTDRSGYSGPWTFSPTVLTNDYYKLLIEEKWQWKKWNGPKQYEDKKTQTLMMLPAD
MAIIQDKKFKEWVKVYAADNDKFFEDFSAVVKKLFELGVPFKEGTETWTFKPVNA

Enzyme Prediction     

No EC number prediction in VBB72132.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	87	339	7.6e-62	0.9803921568627451

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	4.43e-150	73	341	1	252	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	2.31e-83	108	338	32	243	L-ascorbate peroxidase
178467	PLN02879	1.88e-66	107	343	34	251	L-ascorbate peroxidase
166005	PLN02364	4.27e-66	82	338	10	246	L-ascorbate peroxidase 1
223453	KatG	1.68e-63	80	343	66	421	Catalase (peroxidase I) [Inorganic ion transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI58483.1|AA2	7.14e-193	1	354	1	356
QGI89392.1|AA2	7.14e-193	1	354	1	356
CZS76611.1|AA2	1.01e-192	1	354	1	356
QPC66997.1|AA2	4.12e-192	1	354	1	356
QKD47835.1|AA2	5.85e-192	1	354	1	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2V2E_A	6.63e-89	81	354	16	290	Structure of isoniazid (INH) bound to cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae]
2V23_A	7.07e-89	81	354	18	292	Structure of cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae],4A6Z_A Cytochrome c peroxidase with bound guaiacol [Saccharomyces cerevisiae]
4A71_A	1.00e-88	81	354	18	292	cytochrome c peroxidase in complex with phenol [Saccharomyces cerevisiae]
3M23_A	2.42e-88	81	354	13	287	Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M25_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M26_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M27_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M28_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M29_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2A_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2B_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2C_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2D_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2E_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2F_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2G_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2H_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2I_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae]
5EJT_A	2.66e-88	81	354	16	290	Thermally annealed ferryl Cytochrome C Peroxidase crystal structure [Saccharomyces cerevisiae S288C],5EJX_A X-ray Free Electron Laser Structure of Cytochrome C Peroxidase [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SDV9|CCPR_NEUCR	5.33e-209	3	355	6	358	Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=ccp-1 PE=3 SV=1
sp|Q4ING3|CCPR_GIBZE	1.80e-193	1	354	1	356	Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=CCP1 PE=3 SV=1
sp|A4QVH4|CCPR_MAGO7	1.88e-182	1	354	1	361	Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CCP1 PE=3 SV=1
sp|Q4WPF8|CCPR_ASPFU	2.22e-163	3	346	7	357	Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=ccp1 PE=3 SV=1
sp|P0C0V3|CCPR_EMENI	2.49e-161	1	346	1	352	Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ccp1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999741	0.000271

TMHMM  Annotations     

There is no transmembrane helices in VBB72132.1.