CAZyme Information: VBB71429.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB71429.1
• CAZy Family: GT62
• CAZyme Description: Putative protein of unknown function

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362		40363.82	8.0382

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026964:367540-368628(-)

Full Sequence      

MSYHHNNNNNQGSNVQGEAASYYAAAAQQTQQHYQGSNQQDGDQQERGFLGAVGGGIAGG
FGGNKIGGKTGHSKLSTVLGAVAGAVAGHKLQDGVEDWKDKKDEEKEKKKKEEEDRIRRE
EEEKRKREEDEKRRREDDDRRRRDDEDRKRRDEEDRRRREEEDRRRASQPQQQQQHHHSN
QPRDHGVSHGGNFSGSAKDIRLDAHGEFMLHCECRRLDGSYQPTSISLNKIIENSNGNFR
WTSGGANINSCGNKPSSVTVQPGDTLRDIAQRHGTNWQELAKINCLQNPDLIHPGQVIKL
PGGGSQGGQAGGNFGSSARNVRLEDCGKRLVAELRRGDGCWVSSSLNLDERIGNANGTLQ
FK

Enzyme Prediction     

No EC number prediction in VBB71429.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400991	CVNH	1.08e-20	193	360	1	101	CVNH domain. CyanoVirin-N Homology domains are found in the sugar-binding antiviral protein cyanovirin-N (CVN) as well as filamentous ascomycetes and in the fern Ceratopteris richardii.
212030	LysM	9.85e-15	257	300	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
396179	LysM	6.86e-13	258	301	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
197609	LysM	2.13e-11	259	300	3	44	Lysin motif.
131945	spore_safA	1.95e-09	260	301	1	43	spore coat assembly protein SafA. SafA (YrbB) (SafA) of Bacillus subtilis is a protein found at the interface of the spore cortex and spore coat, and is dependent on SpoVID for its localization. This model is based on the N-terminal LysM (lysin motif) domain (see pfamAM model pfam01476) of SafA and, from several other spore-forming species, the protein with the most similar N-terminal region. However, this set of proteins differs greatly in C-terminal of the LysM domaim; blocks of 12-residue and 13-residue repeats are found in the Bacillus cereus group, tandem LysM domains in Thermoanaerobacter tengcongensis MB4, etc. in which one of which is found in most examples of endospore-forming bacteria. [Cellular processes, Sporulation and germination]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB71429.1|CBM50	7.50e-153	36	362	36	362
CAP59788.1|CBM50	8.18e-150	36	362	36	362
CDP22431.1|CBM50	8.18e-150	36	362	36	362
AEO54574.1|CBM50	4.35e-58	39	361	49	339
CEI62111.1|CBM50	7.70e-57	191	360	237	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2L9Y_A	8.60e-45	188	359	2	164	Solution structure of the MoCVNH-LysM module from the rice blast fungus Magnaporthe oryzae protein (MGG_03307) [Pyricularia oryzae 70-15]
5C8O_A	8.18e-41	188	359	2	151	Crystal structure of MoCVNH3 variant (Mo0v) [Pyricularia oryzae],5C8P_A Crystal structure of MoCVNH3 variant (Mo0v) in complex with (N-GlcNAc)3 [Pyricularia oryzae],5C8Q_B Crystal structure of MoCVNH3 variant (Mo0v) in complex with (N-GlcNAc)4 [Pyricularia oryzae]
4UZ2_A	7.54e-08	256	301	3	47	Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
4XCM_A	7.08e-07	256	301	3	47	Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]
3S3Z_A	1.06e-06	209	362	28	172	Crystal Structure an Tandem Cyanovirin-N Dimer, CVN2L10 [Nostoc ellipsosporum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5MK11|CVNH_TUBBO	6.88e-06	313	359	2	48	Cyanovirin-N homolog OS=Tuber borchii OX=42251 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999576	0.000437

TMHMM  Annotations     

There is no transmembrane helices in VBB71429.1.