CAZyme Information: VBB71367.1

Basic Information

• Species: Podospora comata
• Lineage: Ascomycota; Sordariomycetes; ; Podosporaceae; Podospora; Podospora comata
• CAZyme ID: VBB71367.1
• CAZy Family: AA1
• CAZyme Description: Putative Glycoside Hydrolase Family 11

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223		24090.27	9.0205

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcomataTmat	13100	N/A	2652	10448

• Gene Location: location=LR026964:217338-218009(+)

Full Sequence      

MVSFKSLLTVTLATGAAAVPFNATEVFESLQARAGTPSSTGNHNGYYYSFWTDNGGTVNY
QNGNGGSYSVNWQNCGNFVGGKGWNPGNSNRVINYSGQFNPQGNGYLAIYGWTRNPLIEY
YIIESFGTYDPSSGATRLGTFNTDGGTYTIAKSTRYNQPSIEGTKTFDQFWSVRTSKRVG
GSVNVGNHFKAWADKGLRLGSHDYQIVATEGYQSSGSASITVS

Enzyme Prediction     

EC	3.2.1.8:61

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	44	221	2.1e-77	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	6.99e-107	44	219	1	175	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VBB71367.1|GH11	7.24e-163	1	223	1	223
CDP22374.1|GH11	2.95e-162	1	223	1	223
CAP59731.1|GH11	2.95e-162	1	223	1	223
BAA08649.1|GH11|3.2.1.8	9.01e-115	1	223	1	219
ACR92587.1|GH11|3.2.1.8	9.01e-115	1	223	1	219

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H1A_A	2.95e-96	36	222	4	190	Chain A, Endo-1,4-beta-xylanase [Thermochaetoides thermophila],1H1A_B Chain B, Endo-1,4-beta-xylanase [Thermochaetoides thermophila]
1XNK_A	3.49e-96	36	222	4	190	Chain A, endoxylanase 11A [Thermochaetoides thermophila],1XNK_B Chain B, endoxylanase 11A [Thermochaetoides thermophila]
6Y0H_A	1.10e-89	29	223	1	193	High resolution structure of GH11 xylanase from Nectria haematococca [Fusarium vanettenii 77-13-4]
1TE1_B	2.31e-88	36	223	4	190	Crystal structure of family 11 xylanase in complex with inhibitor (XIP-I) [Talaromyces funiculosus]
4XQD_A	9.07e-88	40	223	6	189	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4XQD_B Chain B, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],5ZF3_A Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30],5ZH0_A Crystal Structures of Endo-beta-1,4-xylanase II [Trichoderma reesei RUT C-30],5ZO0_A Neutron structure of xylanase at pD5.4 [Trichoderma reesei RUT C-30]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WG11|XYNA_ASPFU	1.04e-106	1	222	1	227	Endo-1,4-beta-xylanase xynf11a OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=xlnA PE=1 SV=1
sp|B0XXF3|XYNA_ASPFC	1.04e-106	1	222	1	227	Probable endo-1,4-beta-xylanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=xlnA PE=3 SV=1
sp|A1DJ52|XYNA_NEOFI	2.97e-106	1	222	1	227	Probable endo-1,4-beta-xylanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xlnA PE=3 SV=1
sp|P55332|XYNA_EMENI	5.66e-101	1	222	1	224	Endo-1,4-beta-xylanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xlnA PE=1 SV=1
sp|Q9HFA4|XYNA_ASPOR	1.18e-99	1	222	1	231	Endo-1,4-beta-xylanase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xlnA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000422	0.999530	CS pos: 18-19. Pr: 0.9705

TMHMM  Annotations     

There is no transmembrane helices in VBB71367.1.