CAZyme Information: TSTA_125960-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_125960-t26_1-p1
• CAZy Family: GT4
• CAZyme Description: galactose oxidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
491	EQ962655|CGC12	53022.04	5.3565

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962655:4059417-4060952(+)

Full Sequence      

MNLFQAFIVAFGLVVGCVSYEHSPSNATHPWSERIDFPLIPVAVSMIPQTGDLVIWSAYK
NESFGVDASGVTQTAIYNLTNGTVAHYSVDHTEHDMFCPGISLDFKGRIIVSGGDTEEKT
SIFDGESWKPAADMKIPRGYQASTTITDGRIFTIGGSFSGGIGGKDGEIYDLEADEWTLL
PGCSAEPMLTKDAGGLYRSDNHAWLFAWSNGSVLQAGPSPRMHWFDTRGNGSMTFAGTRA
NDSDAMTGMAVIIATSNAHLITVRKPGEPVNVEALDNMHSARAFANAVILPDGKVFIVGG
QSHPIVFTDENASMIPEMWDPKTKKFTELPELPTPRNYHSSALLLPNATVFVGGGGLCPW
KCDANHLDAHIYTPPYLFESDGVTPATRPIISHVANPILKVGQTINVTLSKPVESNQKLT
FSMVRMASSTHTVNTDQRRVNVSPQAATSTLFTLGLPRDPGVLLPGYWHLFAMLNGVPSE
AETILVEPPLA

Enzyme Prediction     

No EC number prediction in TSTA_125960-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA5	24	486	8.7e-190	0.8078231292517006

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
401164	DUF1929	1.93e-21	394	486	1	91	Domain of unknown function (DUF1929). Members of this family adopt a secondary structure consisting of a bundle of seven, mostly antiparallel, beta-strands surrounding a hydrophobic core. The 7 strands are arranged in 2 sheets, in a Greek-key topology. Their precise function, has not, as yet, been defined, though they are mostly found in sugar-utilising enzymes, such as galactose oxidase.
199882	E_set_GO_C	3.53e-21	384	486	2	103	C-terminal Early set domain associated with the catalytic domain of galactose oxidase. E or "early" set domains are associated with the catalytic domain of galactose oxidase at the C-terminal end. Galactose oxidase is an extracellular monomeric enzyme which catalyzes the stereospecific oxidation of a broad range of primary alcohol substrates and possesses a unique mononuclear copper site essential for catalyzing a two-electron transfer reaction during the oxidation of primary alcohols to corresponding aldehydes. The second redox active center necessary for the reaction was found to be situated at a tyrosine residue. The C-terminal domain of galactose oxidase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
276965	Kelch	6.53e-08	277	355	43	112	Kelch repeat. Kelch repeats are 44 to 56 amino acids in length and form a four-stranded beta-sheet corresponding to a single blade of five to seven bladed beta propellers. The Kelch superfamily is a large evolutionary conserved protein family whose members are present throughout the cell and extracellularly, and have diverse activities. Kelch repeats are often in combination with other domains, like BTB and BACK or F-box domains.
404790	Kelch_6	1.09e-06	285	336	4	50	Kelch motif.
128874	Kelch	2.84e-06	294	342	1	43	Kelch domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA17350.1|AA5_2	0.0	1	491	1	511
QKX54465.1|AA5_2	3.89e-236	10	488	10	508
SMR54956.1|AA5_2	2.21e-175	31	486	27	499
SMR57338.1|AA5_2	2.05e-173	31	486	27	499
SMQ52132.1|AA5_2	2.91e-173	31	486	27	499

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C86_A	6.23e-147	31	482	6	476	Novel fungal alcohol oxidase with catalytic diversity among the AA5 family, apo form [Colletotrichum graminicola M1.001],5C92_A Novel fungal alcohol oxidase with catalytic diversity among the AA5 family, in complex with copper [Colletotrichum graminicola M1.001]
2EIC_A	1.90e-133	23	486	153	637	Chain A, Galactose oxidase [Fusarium graminearum]
1T2X_A	5.35e-133	23	486	153	637	Glactose oxidase C383S mutant identified by directed evolution [Fusarium sp.]
2WQ8_A	1.01e-132	23	486	175	659	Chain A, GALACTOSE OXIDASE [Fusarium graminearum]
1GOF_A	1.07e-132	23	486	153	637	NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],1GOG_A NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],1GOH_A NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],2EIE_A Chain A, Galactose oxidase [Fusarium graminearum],2JKX_A Chain A, GALACTOSE OXIDASE [Fusarium graminearum],2VZ1_A Chain A, GALACTOSE OXIDASE [Fusarium graminearum],2VZ3_A Chain A, Galactose Oxidase [Fusarium graminearum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0CS93|GAOA_GIBZA	1.78e-131	23	486	194	678	Galactose oxidase OS=Gibberella zeae OX=5518 GN=GAOA PE=1 SV=1
sp|I1S2N3|GAOA_GIBZE	2.52e-131	23	486	194	678	Galactose oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GAOA PE=3 SV=1
sp|Q9FYG4|GLOX1_ARATH	1.92e-12	276	486	390	614	Aldehyde oxidase GLOX1 OS=Arabidopsis thaliana OX=3702 GN=GLOX1 PE=2 SV=1
sp|Q3HRQ2|GLOX_VITPS	2.35e-08	95	488	94	523	Aldehyde oxidase GLOX OS=Vitis pseudoreticulata OX=231512 GN=GLOX PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000000	1.000045	CS pos: 16-17. Pr: 0.9950

TMHMM  Annotations     

There is no transmembrane helices in TSTA_125960-t26_1-p1.