CAZyme Information: TSTA_122960-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_122960-t26_1-p1
• CAZy Family: GT32
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
444	EQ962655|CGC19	47724.40	9.2728

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962655:3259502-3260948(+)

Full Sequence      

MFVNLLWILCLALSRFVLGQTDNGIQNDPISVFVTSPGSGSGNYVFALNVPSNSGDIYFH
LSGPAAYSWVAVGTGSKMKDSLMFIAYLNSTGNGVTLSPRISTDETEPSYSSSINVETLS
GTGVFNGTISVNARCTNCTKWNKGSLNLKSTSQSFIYGLGPSSGSLKKLQSDSLSAGIER
HSVYGNFVMNMTKATGGTDGTTLLSTTFSSVTTSSGASADGDQTHDSNWPVIIHAVALSV
AFIILMPGGAILLRIIPASVRWHWVNQSVATILAGIGGVIGLWLSTMYNRSSSYNSAHQV
LGIICVVAVLVQWFLGFWHHWQYKKHQTPTKYGAVHLHMGRIILVLAIVVGAIGLSWSSV
KTGVIIAYVVIAGVIVVVVLALSMWKRHFSESLSFLPAFGPSKRSVNSEGSYENLADPFS
NRYEYRSYESNTPLASYPNANNSR

Enzyme Prediction     

No EC number prediction in TSTA_122960-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA8	39	195	2.1e-21	0.8791208791208791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
187688	CDH_like_cytochrome	1.25e-46	36	191	13	168	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
406418	CDH-cyt	4.71e-25	39	195	15	174	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
176490	Cyt_b561_FRRS1_like	5.59e-25	225	368	30	175	Eukaryotic cytochrome b(561), including the FRRS1 gene product. Cytochrome b(561), as found in eukaryotes, similar to and including the human FRRS1 gene product (ferric-chelate reductase 1), also called SDR-2 (stromal cell-derived receptor 2). This family comprises a variety of domain architectures, many of which contain dopamine beta-monooxygenase (DOMON) domains. The protein might act as a ferric-chelate reductase, catalyzing the reduction of Fe(3+) to Fe(2+), such as associated with the transport of iron from the endosome to the cytoplasm. It is assumed that this protein uses ascorbate as the electron donor. Belongs to the cytochrome b(561) family, which are secretory vesicle-specific electron transport proteins. Cytochromes b(561) are integral membrane proteins that bind two heme groups non-covalently, and may have six alpha-helical trans-membrane segments.
214769	B561	6.67e-12	233	355	1	129	Cytochrome b-561 / ferric reductase transmembrane domain. Cytochrome b-561 recycles ascorbate for the generation of norepinephrine by dopamine-beta-hydroxylase in the chromaffin vesicles of the adrenal gland. It is a transmembrane heme protein with the two heme groups being bound to conserved histidine residues. A cytochrome b-561 homologue, termed Dcytb, is an iron-regulated ferric reductase in the duodenal mucosa. Other homologues of these are also likely to be ferric reductases. SDR2 is proposed to be important in regulating the metabolism of iron in the onset of neurodegenerative disorders.
397345	Cytochrom_B561	2.19e-07	234	355	2	130	Eukaryotic cytochrome b561. Cytochrome b561 is a secretory vesicle-specific electron transport protein. It is an integral membrane protein, that binds two heme groups non-covalently. This is a eukaryotic family. Members of the 'prokaryotic cytochrome b561' family can be found in pfam01292.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX59257.1|AA0	2.51e-143	20	390	24	391
QSZ36681.1|AA0	1.04e-66	23	354	21	340
CAE7013938.1|AA8	2.97e-43	46	373	33	367
SMR55355.1|AA0	9.54e-43	46	381	27	356
SMR57731.1|AA0	9.54e-43	46	381	27	356

PDB Hits     

TSTA_122960-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

TSTA_122960-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000202	0.999768	CS pos: 19-20. Pr: 0.9801

TMHMM  Annotations     

Start	End
231	253
262	284
299	321
342	359
363	385