CAZyme Information: TSTA_122100-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_122100-t26_1-p1
• CAZy Family: GT32
• CAZyme Description: beta-N-acetylglucosaminidase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
950		103459.67	6.4109

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962655:2999896-3002916(-)

Full Sequence      

MAPKDGTLPPIWDDLDWQMGQLFMMGFDGTTVDDQIRSLIENYHVGSIMLSAKNLKSAEE
TTKLILELQTIARDAGHPVPLLIALDQENGGVNSLYDEIYIRQFPSAMGIAATGSKRLAH
EVASATAQELRAVGVNWILGPVLDVLTNVRSQPIGVRTSGDDPQEVSQYGVETMKGYQEA
GLVTCGKHFPSYGNIEFVGSQTDVPVITESLEQLSLSALVPFRNAIANGLDAMMVGGVAM
SSAGVNVMHACLSEQVVDGLLRKEMKFDGVVVSECLEMEALTHNIGVGGGTVMAMKAGCD
VALLCRSYPFQLEALNGLKLGVENGMISRSRITQSLQRVLSMKARCTTWEQALNPGGIEV
LTHMQPSHTSLSTRAYDSSITLVRDTNNLLPLPQILEPDEELLLLTPLVKPLPASAVSRS
MLDLMTASPDPSASWEKGSSISSGESVFREFGRSLARQRSGRVLHTSYTSTGVRPIHESL
IDRASAVVILTADSNRNLYQHGFTKHVSMICKSQYSQTGERREKPVIVVAVSSPYDFAID
PSIGTYICTYDFTETALQALVKVLYGELSPTGSLPGTVSRSQKIHQSRQHWLVEAWNEQR
DSEALDALLDAVRESGSHAELTNVSSHSFLLRNDDVDEAHFVVRNSTTQALYGFCTTYFF
RSTGTGVIGSIFVDPARRKLSIGHSLHNRAIRSLLQRKGVKRFQLGSRLPSIYLGIPAAN
PVERKRLRQWFAQLGWNTALSRPLCSVLLRPLSTWTAPEGLAKSLHTNEVDYDLVHGWEY
AESIFDHIKTNSRQGVMEIYKMALNGAPHSGVIRAKRPEDGAILGSVVIYNSQSAIAEYI
PALHKKDKEREKQVNGSNTSTVNGSNNTGGGGGVSSPVISPSVGEYATLMQGLILLGIKQ
VRKSGADAVMLDCVDGDGNFDSLTAMGFTVLHSFEEVTCDATTWKLMQPS

Enzyme Prediction     

No EC number prediction in TSTA_122100-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	78	303	5e-55	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	4.25e-73	18	392	6	350	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.06e-67	15	342	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	8.91e-37	19	353	1	316	beta-hexosaminidase; Provisional
178629	PLN03080	1.01e-11	104	577	114	587	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA17051.1|GH3	0.0	1	950	1	952
QKX54839.1|GH3	0.0	1	948	1	923
BCS15461.1|GH3	0.0	1	950	1	931
BAE65506.1|GH3	0.0	1	950	30	961
QMW48185.1|GH3	0.0	1	950	1	932

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	3.55e-88	13	737	7	680	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	3.52e-70	15	579	13	532	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	5.19e-48	15	575	44	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	6.53e-48	15	575	18	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.02e-47	15	575	48	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	2.67e-47	15	575	44	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	6.12e-36	16	575	29	552	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	3.85e-35	30	579	49	597	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	2.84e-31	24	334	7	310	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|B7UYS5|NAGZ_PSEA8	6.96e-29	24	319	6	292	Beta-hexosaminidase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000037	0.000000

TMHMM  Annotations     

There is no transmembrane helices in TSTA_122100-t26_1-p1.