CAZyme Information: TSTA_117210-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_117210-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
842		92011.42	5.3487

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962655:1675836-1678471(+)

Full Sequence      

MVQLDIEKTLSELDLNEKIALTAGADFWHTVPIERLKIPSVRTSDGPNGVRGTRFFNGVP
SACLPCSTALGSTWDVNLLEQIGELLGDEARSKGVHVLLGPTINIQRSPLGGRGFESFSE
DGLLSGVLAGYYCKGVQSKGVGATLKHFVCNDQEHERMAVDTIVTARALREIYLVPFQQA
LRICQMACFMTAYNKINGCHVSENASIIGDILRKEWKWNGLVMSDWFGTYSTAEAINAGL
DLEMPGPTRWRGSILNHAINSRKVADHVLDERVRNVLNLVNHAGKSDIPFGAEEKGLNRP
EDQKLLRRAAAESIVLLRNNNSVLPFDKIKPIAVIGPNSKVAAYCGGGSASLPPYYTVTP
FEGITNASKADVKFSQGAYAHQTLPPLGPLMKTLDGKKQGFEFKAYLEPPEERNSDSKPV
DELHLVNSTGFLADYKNPRIPGQLFYADMEGTFTPAEDGLYDFGVIVIGSGKLFIDGELV
VDNATTQRQGTAMFGSATVEEKGSKELKGGTSYKILFQYGSRPTSKLENRSVIDFGLGGF
AFGTGKRIDKEESIKQAVDLASKMEQVILVAGLNGEWETEGNDREHMDLPPGTDELISRV
LDVNPNVAVVIQSGTPVTMPWIDKANVLAQAWFGGNELGNGLADVLYGDVNPAGKLSLTI
PARLEDNPSYLNFGSERGRVLYGEDVYVGYRYFEKAGVKPLFPFGYGLSYTTFARSGLSL
QVDSEKPILEDGERITASLTVANTGSVAGAETVQLWIQPPAIANIKRPVRELKGFTKVHL
QPGEKKDVSITVEKKIATSFWDEIRESWASEKGEYTVLITGTGEEALSEKFSVEKSRYWI
GL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	245	4.8e-63	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.61e-78	35	819	101	750	beta-glucosidase BglX.
224389	BglX	1.88e-72	26	376	48	395	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.38e-50	314	690	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.40e-37	31	279	59	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	3.58e-34	10	793	57	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA16623.1|GH3	0.0	1	842	1	842
QKX61249.1|GH3	0.0	1	842	1	839
ATQ35958.1|GH3	0.0	1	842	1	839
AJA36818.1|GH3	0.0	1	842	1	838
BAE61980.1|GH3	0.0	1	842	1	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.71e-279	1	842	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.05e-273	5	842	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	7.73e-152	5	819	4	653	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.49e-113	9	819	8	648	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	6.58e-99	6	837	4	717	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8Y5|BGLI_ASPOR	0.0	1	842	1	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B0Y8M8|BGLJ_ASPFC	0.0	1	842	9	865	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2
sp|Q5BB53|BGLI_EMENI	0.0	1	842	1	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|Q0CAF5|BGLI_ASPTN	0.0	1	842	1	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	0.0	1	842	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.993824	0.006198

TMHMM  Annotations     

There is no transmembrane helices in TSTA_117210-t26_1-p1.