CAZyme Information: TSTA_116210-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_116210-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: cell wall glycosyl hydrolase YteR, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
392		43693.08	4.7453

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962655:1406044-1407325(+)

Full Sequence      

MRLSQWLPLPILTLLSTTITGSSTNYSTWMADSIISRGQGIAPEEPTVSTYLQIGIVQSA
LLRLIDAPFVASDCTKDDYRAYVRRGSESVLGKLLNASQDISYPLDRFSLGRGLLAEYYD
EGNRTVKSALDALNESIALQPRNQYGGLWYFTYPNWSYLDGMYSYTSFTSLYTTHFDPPA
PNTATDAFQLDLLWSHCYDNTSGLLFHGYDASKTAVWADPVTGASPIVWGRALGWYFMAL
VDWLDLNSFQPDPLQWGYVHRRFVALADAIANVVDPVSGAWWQVLNFAGREGNYIESSAS
AMFTYGLYKGVRLGYLPASRYRETANKAYEYLVNTFVVKNQNGTLGWNGTVSVCSLNSTA
SYEYYVTQPLLFNSVHGSASFVLASLENEMAV

Enzyme Prediction     

No EC number prediction in TSTA_116210-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	55	388	5.3e-69	0.9397590361445783

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	7.58e-39	76	390	47	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
226678	YesR	1.24e-38	103	387	77	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA16534.1|GH105	4.52e-206	1	390	1	394
QKX54638.1|GH105	9.92e-175	5	391	6	408
QRD85043.1|GH105	2.62e-144	26	391	41	418
UDD61061.1|GH105	9.88e-142	26	391	41	418
BAE63195.1|GH105	7.78e-140	26	391	41	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	2.11e-50	26	389	4	359	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	4.09e-33	105	389	87	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.74e-32	105	389	77	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	6.46e-07	188	333	196	329	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
5NOA_A	6.46e-07	198	362	197	359	Polysaccharide Lyase BACCELL_00875 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	2.10e-32	105	389	87	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	1.04e-25	200	388	35	228	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	1.04e-25	200	388	35	228	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000316	0.999664	CS pos: 21-22. Pr: 0.9811

TMHMM  Annotations     

There is no transmembrane helices in TSTA_116210-t26_1-p1.