CAZyme Information: TSTA_115320-t26_1-p1

Basic Information

• Species: Talaromyces stipitatus
• Lineage: Ascomycota; Eurotiomycetes; ; Trichocomaceae; Talaromyces; Talaromyces stipitatus
• CAZyme ID: TSTA_115320-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493	EQ962655|CGC1	52112.99	5.9282

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_TstipitatusATCC10500	12629	441959	146	12483

• Gene Location: location=EQ962655:1158011-1159633(+)

Full Sequence      

MQLIKCLGTLSIYHGICSASTVTIDPKSQLQVIDGFGISQAFGRASQFKALAQGPQQKGL
DYLFNTTTGAGLSIIRNRIGSGSNSADSIEPNSPGSPNAKPTYIWDGDDEGQVWFSQEAM
GYGYLHYYNQTGIPITHVGFLNEPDGSDFMLSDAAQAASMIPILHSTLEIEGFGHVKMTC
CDNIGWNSQKAYTKNLTKAGMDEYLSVITSHMYSSDATTPMDTNLTTWITEAADLTNPWC
TTWYSTGSLCEGFTWAVKLAEGIVNAGLSAYLYWEGVEVSQQQAASYLVLSDGTDVYPSG
RLWAMAHWSRYIRPGAHRVATTGTVPNTIIGAFVNTDSSLVTVLTNSGGIAQNVELDLPG
ASSDNVFAVVTDQSSQMAPLDMNVSNGIVSVSVPAYGVITVKSEGTVAGGSSNIASPSKI
NIATPSSTAISSSSSVSRARSSSAIPSSSRAVSKSAQNSSAMPGKVQASTASACEAPIPS
QVHHNHHGHHSHH

Enzyme Prediction     

No EC number prediction in TSTA_115320-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	124	401	8e-90	0.6343115124153499

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227807	XynC	4.96e-14	6	400	19	425	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
396577	Glyco_hydro_59	8.17e-06	60	316	28	283	Glycosyl hydrolase family 59.
407314	Glyco_hydro_30C	3.60e-05	315	366	1	53	Glycosyl hydrolase family 30 beta sandwich domain.
405300	Glyco_hydr_30_2	4.15e-04	19	144	1	128	O-Glycosyl hydrolase family 30.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT73001.1|GH30_7	7.41e-139	20	402	21	448
QKD62186.1|GH30_7	1.79e-138	7	402	7	448
QGI99497.1|GH30_7	5.94e-138	20	402	21	448
QGI85808.1|GH30_7	1.68e-137	20	402	21	448
QGI68607.1|GH30_7	1.68e-137	7	402	7	448

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M5Z_A	2.61e-91	21	400	24	450	Chain A, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	4.35e-77	18	401	1	445	Chain A, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	7.40e-76	18	401	8	452	Chain AAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6IUJ_A	4.00e-67	22	404	24	472	Chain A, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	2.07e-66	22	404	95	543	Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q1N4|XY30A_MYCTT	5.66e-77	18	401	25	469	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.175685	0.824314	CS pos: 19-20. Pr: 0.6801

TMHMM  Annotations     

There is no transmembrane helices in TSTA_115320-t26_1-p1.